KEGG   Dictyoglomus thermophilum: DICTH_0409Help
Entry
DICTH_0409        CDS       T00774                                 

Definition
(GenBank) serine phosphatase
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
403088..404212
Genome map
AA seq 374 aa AA seqDB search
MNFAFKSKEGEEVCGDSIKIKRNEDRVVVTVSDGLGSGIKASILSTLTASLTTTMLFNDM
PVDEVMKSILATLPKCKVRDISYANFCSVLFKAKENICYIAEYEFPVVLLFRKDDFIELK
KERLFVEDREIKESYFTPQEGDLLFIMTDGVSQAGLGSKLYPLGLGIENIKREIFNLIRY
KLSPKEIVNHLIDKAKRLDKGIKGDDALCCALHFRTFNRLNIMVGPPSDSNLDEYVVNRF
INMPGRRVICGGTTAQIVGKVIGREISLDLKTISEDSPPVGYMEGVDLVTEGIITLTQVF
RYLDGQTNKVGYGASLIVDFIEKADEVCFIVGKAINPAYQNPLFSYDMSLKFKIVNDIAK
ILERKGKIVNIEAY
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgaattttgcctttaaaagtaaagagggagaggaagtttgcggagattccattaagatt
aagaggaatgaggatagagtagtggttaccgtatctgatggacttggaagtggtataaaa
gcaagcattctttctactcttactgcctctttaactactactatgctttttaacgatatg
cctgtagatgaggtaatgaagagtattcttgcaactttgcccaaatgtaaagtaagggat
ataagttatgccaacttttgtagtgtgctttttaaagctaaagaaaatatctgctatata
gcagaatatgagtttcctgtggttcttttgttcagaaaggatgactttattgaacttaaa
aaagaaagattatttgtagaggatagggagataaaagaaagttactttacccctcaagag
ggggatctattatttataatgaccgatggggtttcacaagcaggccttggcagtaagctt
tatcctttagggttgggaatagagaatataaaaagagaaatttttaatcttatcagatat
aagctttctccaaaagagattgtaaatcatcttattgataaggcaaaaagattggataaa
gggataaaaggtgacgatgctctctgttgtgctctacattttaggacttttaataggttg
aatattatggttgggcccccgtcagattctaatcttgatgagtatgtggttaatagattt
ataaatatgccaggaaggagggtgatatgcggaggtactactgcacagatagtaggtaag
gtgataggtagggagatttctcttgacctaaaaactatatcagaggattctcctcctgtg
ggatatatggagggagtagatttagtaaccgaaggaataattactcttactcaggtattt
agatatcttgatggtcaaaccaataaggttggctatggagcaagtcttattgttgacttt
atagaaaaagcagatgaggtttgctttattgtaggcaaagctataaatcctgcttatcag
aatcctctttttagctacgatatgtccttaaagtttaagattgttaatgatattgccaag
attttagaaagaaaaggaaagatcgttaatattgaagcttattaa

DBGET integrated database retrieval system