KEGG   Dictyoglomus thermophilum: DICTH_0461Help
Entry
DICTH_0461        CDS       T00774                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dth  Dictyoglomus thermophilum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dth00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
453422..454624
Genome map
AA seq 400 aa AA seqDB search
MIVEITPEFLEKEMARVGAHPVSFEIFERKAQIIPLKIFNISSPTANIIKQEMLSLGGDA
IVHKNVINCKVENSDIILLGTKKHYELLLQKLEKNNYFDLPRVFQELKEYLLKEKVREIS
SPWGRVISFNRILVMGIINVTPDSFYSGSRKMQIDEILKTAEDMIMNGVDIIDIGGQSTR
PGSEPVSLEEEISRVIPAIENIRRNYPDVLISVDTYYSQVAKLAVEKGADIVNDISAFRF
DESLVKVVAELKVPYILMHMKGTPKDMQKNPYYDDVIREIIEFFEERIEYANKNGVDPEK
IIIDPGIGFGKRYEDNLEIMARLKEFKSLKKPILIGASRKSFIGKALGDLPPEERLEGTL
GITALCVLNDVDIIRVHDVKENKRVVKVLEEIKCIRSSLQ
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgatagtagagattactcctgaatttttggaaaaagagatggcaagagtaggggctcat
ccagtttcctttgaaatctttgagagaaaggctcaaattattcctttgaagatttttaat
atatcttctcctactgcaaacataattaagcaggagatgctttccttaggtggggatgct
atagtccataaaaatgttataaattgtaaagtagaaaatagtgatattattcttcttggt
actaaaaaacattatgagcttttgcttcaaaagttagagaaaaataattactttgatctt
ccaagggtttttcaagagttaaaggaatatttattaaaagagaaagttagagagatttct
tctccatggggtagggttataagtttcaacagaattttagtcatggggataataaatgta
actcctgattctttttatagtggatcaaggaagatgcaaattgatgagattctaaagact
gctgaagatatgataatgaatggtgtggacataattgatataggtggacaatctactcgt
cctggatctgagcctgtaagtttagaagaggagatatcaagggttattcctgctattgag
aatataaggagaaattatcctgatgtgttaatttctgttgatacatattattcacaggtg
gcaaagttggctgttgaaaagggggcagatatagtaaatgacataagcgcttttaggttt
gatgaaagtcttgttaaggtggtggctgagttaaaggtgccatatattcttatgcatatg
aagggaactcctaaggatatgcaaaaaaatccttactatgatgacgtgataagagagatc
atagagttttttgaagagagaatagaatatgccaataagaatggagttgatccggagaaa
ataattattgacccagggattggttttggaaaaagatatgaagataatcttgagattatg
gcaaggttaaaggaatttaagagtcttaagaagcctatacttataggagcatcgagaaag
agctttattggaaaagctttgggcgatcttcctcctgaggaaagacttgaaggaactctt
gggattactgctttgtgtgtattgaatgatgtggatattattagagtgcatgatgttaag
gaaaacaaaagagtggttaaagtgttggaggaaataaagtgcataaggtcttcattgcaa
tag

DBGET integrated database retrieval system