KEGG   Dictyoglomus thermophilum: DICTH_0479Help
Entry
DICTH_0479        CDS       T00774                                 

Definition
endo-1,4-beta-xylanase A (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
dth  Dictyoglomus thermophilum
Brite
Enzymes [BR:dth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     DICTH_0479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
473838..474479
Genome map
AA seq 213 aa AA seqDB search
MRRSLLLAILLIFGLFLSLTFGQTLTATAKYGKPKIDAEMDEVWKNAEEYVTDRYVQGVK
GKVAYAKFRVLWDEESIYVWAEVYDSVLNKDNTNPWEQDSVEIFVDEGNEKATSYDNNDA
QYRVNFENVQSYGTNASRDYFVTATKKTDFGYIVEAQVKMRTRKLKEGDVIGFDVQVNDA
DRFGSRVGIIAWNETENENWRNPSYLGNLKLVK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaggtcactacttcttgctattcttttgatttttgggctcttcctttctttgacc
tttggacaaactttaactgcaacagctaagtatggtaaacctaagattgatgcagagatg
gatgaggtatggaagaatgctgaagagtatgttactgatcgctatgtacaaggggtaaag
gggaaggtggcatatgcaaaatttagagtactttgggacgaagaaagtatatatgtttgg
gctgaggtttatgattcagtcctgaataaggataatacaaatccttgggagcaagattct
gtagagatatttgtagatgaaggaaatgaaaaggcaacatcctatgataacaatgatgct
caatacagagtcaattttgaaaatgtgcaaagctatggtactaatgcctctcgtgattac
tttgtaacagccacaaagaaaactgattttggttatattgtagaggcacaggtaaagatg
agaacaaggaaattaaaggaaggagatgtaattggatttgatgtacaagtaaatgatgca
gacaggtttggaagtagagttggaatcattgcatggaacgaaactgaaaatgaaaactgg
agaaatccatcttaccttggaaacttaaagcttgttaagtaa

DBGET integrated database retrieval system