KEGG   Dictyoglomus thermophilum: DICTH_0506Help
Entry
DICTH_0506        CDS       T00774                                 

Definition
endoglucanase H (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
dth  Dictyoglomus thermophilum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DICTH_0506
Enzymes [BR:dth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     DICTH_0506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
504906..505844
Genome map
AA seq 312 aa AA seqDB search
MGKIPIRRGINFGDTLEAPYEGAWGGHIIKDEYFKLIKDAGFDHVRIPIKWSVYTQKEYP
YSIEKRIFDRVDHLIEEGFKNSLYIVINIHHYDEIMEEPLREKDRFLAIWRQISEHYKDY
PDQLYFELLNEPTYNLNSDLWNQFLKEAVEVIRKTNPERKIIIGPDNWNNLYNLPKLEIP
ENDKNIIVTFHYYNPFPFTHQGAGWVKVNLPVGVKWLGTEEEKKDVERELDMAVDWAKEH
GDIPLYMGEFGAYSKADMESRVRWTDFVARSAEKRGIAWAYWEFYSGFGVFDSEKNEWRK
PLLKALIPETKI
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaattcctattagacgtggaattaatttcggagatactttagaggctccttat
gaaggagcttggggtggacatataataaaggatgagtattttaagcttattaaggatgcg
ggttttgaccatgttagaattccaataaaatggagtgtttatactcaaaaagagtatcca
tattctattgagaaaagaatctttgatagggttgatcacttgatagaagaaggttttaaa
aatagtctctatattgttataaatatccatcattatgatgagattatggaagaaccacta
agggaaaaagatagatttttagccatatggaggcaaatttcggagcattataaagattat
cctgatcagctttattttgagcttttaaacgagccaacttataatttaaacagtgattta
tggaatcaatttttaaaagaggcagttgaagtcataaggaaaaccaatccggaaaggaag
attattatagggccagataattggaataacctttataatcttcccaaattagaaattcct
gaaaacgataagaacattatagttacttttcattattacaatccttttccctttactcat
caaggagcaggatgggttaaagttaatttgcctgtaggggttaagtggttgggtacagaa
gaggagaaaaaagatgtagaaagggaacttgatatggctgtggattgggcaaaagagcat
ggtgatatacctctttatatgggagaatttggagcatattcaaaggcagacatggaatca
agggtgagatggacggattttgtagcaaggtctgcagagaagagaggaattgcttgggca
tattgggagttctattctggatttggggtttttgattctgaaaaaaatgagtggagaaag
cctctgctcaaggctttaatacctgagacaaagatataa

DBGET integrated database retrieval system