KEGG   Dictyoglomus thermophilum: DICTH_0516Help
Entry
DICTH_0516        CDS       T00774                                 

Definition
endoglucanase M (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
dth  Dictyoglomus thermophilum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dth00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(518335..519345)
Genome map
AA seq 336 aa AA seqDB search
MKELIKKLTEIKSPSGREDNIRNAILEELKGYIDGYEIDKLGNLIVWKKGKKDGKILLDA
HMDEIGVLATYIDEKGFIRIEPIGGVSPYNLLGSSIAFPQAEGFVGVEGETLEELSKNIK
NLDFDKIFVDIGAKSREEAEKLVPPGTFGVYSANFKDLGERLVSKAMDDRIGCAIIIEVF
KRSNPYYTLYGTFSIQEEIGLVGASVVAFDIKPDLAIAIDVTAHSDTPKGPKRMSLELGK
GPAIKIKDSASISDRRIVEKLKNIAEKNGIPYQIEILLRGGTNAAALQRTGEGIPAGTLS
IPTRYVHSPHEMIDINDVENAIRILKILVESDESLL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagcttatcaaaaagttaacggaaatcaaatctcccagtggtagagaggataac
ataagaaatgcaatcctggaagaattaaaaggatatattgacgggtatgagatagacaaa
cttggaaatctaatcgtttggaaaaaaggtaaaaaagatgggaaaatactccttgatgcc
catatggatgaaattggtgttcttgcaacttatattgatgaaaaaggatttattagaata
gaacctattggaggagtttctccttataatttattaggaagcagtatagcttttcctcag
gcagaaggatttgtaggagtagaaggagaaactttagaagagctctccaaaaacattaaa
aatcttgattttgataagatatttgtagacattggagctaaaagcagagaggaagctgaa
aagcttgttcctcctggaacctttggtgtatactctgcaaattttaaagatctgggagaa
agattggtctcaaaagctatggatgatagaataggatgcgccataataattgaagttttt
aaaagatcaaacccttattacactctctacggtactttctccattcaagaagaaattgga
cttgtaggagcaagcgtagttgcctttgacataaaacctgatcttgctatagccattgat
gtaactgcccattctgacactcctaaaggcccaaagagaatgtcccttgagctagggaag
ggacctgctatcaaaataaaagatagtgcttctattagtgatagaagaatagtggaaaaa
ctcaaaaatatagcagagaaaaatggtataccctatcaaattgaaattctacttcgtggg
ggtaccaacgctgctgcactccaaagaacaggagaaggtattccagctggaactctctcc
atacctacaagatatgtgcattcaccccatgagatgattgatataaatgatgtggaaaat
gcaattagaattcttaaaatattagtagaaagtgatgaaagtctcttataa

DBGET integrated database retrieval system