KEGG   Dictyoglomus thermophilum: DICTH_0517Help
Entry
DICTH_0517        CDS       T00774                                 

Definition
(GenBank) endoglucanase M
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(519347..520351)
Genome map
AA seq 334 aa AA seqDB search
MKLFLKELSDIPGVSGFEGKVREFIKEKIKDKVDQIEVDKLGNLIAFKKGKVNKKLMISA
HMDEVGFIVSNIEEDGKLSILPLGSIDPRVVLGKKVVIGEKQILGVIGSKPIHLMEGYEK
VSFENIKVDIGATKKQEAEAKVKIGDFVSFAPNAMIHGEWISGKALDDRGGCSLLIDLIL
KDLDLYYDTFFAFVIQEETGLRGSGPCAFKIKPDLAIVVETTTSGDNPEFPEARRSSELG
KGPVITPAHRGYVNDERLFNFAVKVAEENKIPYQIKRRTAGGTDAARIAITTGTPSLVIS
IPSRYIHSPICVLNINDYRNTFKLLSLILTKEVL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgtttttaaaggagctatcagatataccaggagtttctggctttgagggaaag
gtaagagaatttattaaagagaagataaaagacaaagtagaccagattgaagtagacaaa
ttagggaaccttatagcctttaaaaaaggcaaagtaaacaaaaaactcatgatttcagct
catatggatgaggttggttttatagtaagcaacatagaagaagatggaaaactaagtata
ctaccattaggatctattgaccctagggtagtgttaggtaaaaaagtagttataggagaa
aaacaaatattaggagttataggttcaaaacctattcatcttatggaaggatatgaaaag
gtatcttttgaaaacatcaaagtagatattggagccacaaaaaaacaagaagctgaggca
aaagtaaaaataggagactttgttagctttgcacccaatgctatgatacatggagaatgg
atatctggaaaggctttagatgatagagggggatgttccctattgatagacttaatactt
aaagatttagatttatactacgacaccttcttcgcttttgtaatccaagaggagacagga
ttaagaggatctggaccctgtgctttcaagataaaacctgacctcgcaattgtggtagaa
acaaccacctctggagataatcctgagtttccagaagctagaagatcttcagagttaggc
aaaggtccagttatcacgcctgctcacagaggctatgtaaatgatgaaaggctttttaat
tttgccgtaaaagtagccgaagaaaataaaattccttaccagataaagaggagaaccgca
ggaggcactgatgctgcaagaattgccataactacaggtactccttccttggttatttct
attccatcaagatatattcattcccctatatgtgtgttaaatatcaacgactatcggaat
acttttaagcttctttctttaatactcacaaaggaggtcttatag

DBGET integrated database retrieval system