KEGG   Dictyoglomus thermophilum: DICTH_0534Help
Entry
DICTH_0534        CDS       T00774                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dth  Dictyoglomus thermophilum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DICTH_0534 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DICTH_0534 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DICTH_0534 (trpB)
Enzymes [BR:dth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DICTH_0534 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
534661..535863
Genome map
AA seq 400 aa AA seqDB search
MRKIELKNLPDERGYFGEFGGRFVPETLMEPLLQLEEAYNKYKNDERFKQELDYYLKTYV
GRPTPLYFARNLSEKLKAKIYLKREDLCHTGAHKINNAIGQALLAKYMEKKRLIAETGAG
QHGVATATVAALFGFKCTVYMGEEDCERQKINVLRMKLLGAEVIPVKVGSKTLKEAINEA
LRDWVAHPEDSYYLLGSVVGPHPYPVIVRDFQKIIGEEVKKQILELENRLPDYLVASVGG
GSNSIGLFYPFLEDDVKIIGVEGGGKGLESGLHSASINFGRVGVLHGAKMYLIQDENGNV
SPTHSISAGLDYPGVGPEHSFLAKIGRVKYDIATDDVALKGFLALSELEGIIPALESAHA
IGYVIEHRDEFPEKEPIIVINLSGRGDKDLEIISKYVGEK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatagagctgaaaaatcttcccgatgaaagaggatattttggagaatttgga
ggaaggtttgttcctgaaactttaatggagcctttgcttcaattagaggaggcatataat
aagtacaagaatgatgaaagatttaagcaggaattagattactatcttaagacttatgtg
ggtagacctactcctctttactttgcaaggaatctttctgagaaattgaaggcaaaaata
tacttgaaaagagaggatctttgtcatacaggggctcataagataaataatgctattgga
caggcactacttgctaaatatatggaaaaaaagagattaatagcagaaactggagctgga
cagcatggggttgctacggcaactgtggcagcactttttggattcaaatgtactgtgtat
atgggcgaagaggattgcgaaagacaaaaaattaacgttttaagaatgaaacttttaggg
gcagaggtcattcctgtaaaagtaggatcaaaaactttaaaagaggcaataaatgaagcg
ttgagagattgggtggcacatccagaagatagttattatcttttaggatcagtggtaggt
cctcatccttatcctgtaattgtaagagattttcaaaagataataggagaagaggtcaag
aagcaaatattagagttagaaaatagacttcctgattacttagttgcttctgtcggagga
gggagtaattctataggacttttttatccttttctggaggatgatgtaaagatcataggt
gttgaaggaggaggaaaaggcttggagtctggtttacattctgctagtatcaactttgga
agagtaggtgttcttcatggggctaagatgtatcttatccaagatgaaaatggaaatgtt
tctcctactcactccatatctgctggattagattaccctggagtaggaccagaacacagt
ttccttgctaagattggcagagtaaaatatgatattgctacagatgatgtggcgttaaaa
ggttttttggccctctcggagttggaaggaattattccggctttggagagtgctcatgcc
ataggttatgtgattgaacacagggatgaatttcctgaaaaggagcctattatagtaata
aacctttctggaagaggagataaagatttagaaataatatcaaagtatgtgggggagaaa
taa

DBGET integrated database retrieval system