KEGG   Dictyoglomus thermophilum: DICTH_0535Help
Entry
DICTH_0535        CDS       T00774                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dth  Dictyoglomus thermophilum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DICTH_0535 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DICTH_0535 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DICTH_0535 (trpA)
Enzymes [BR:dth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DICTH_0535 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
535863..536624
Genome map
AA seq 253 aa AA seqDB search
MANLLEKFKNRDKSLLFVPFFVSGFPDFDFLEKFLFKNKDKIDILELGVPFSDPVADGPI
LQEINYRAMVKGVNLNNTLDWLLDSGITKKIDVILLLYFNLIQNKLEEKLKRFKEVGIKG
LVIPDLPLEEAEKLIPLFNEHNLDLILFISPTTREERIRKILDIAPSFLYCISVKGVTGE
RDRLPEEGVAFISRVKKETNKPLVWGFGLGSSYQINSLKGLVDGVIVGSAIGKRLLNNED
IQDYFDELYKATL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggctaacttattagagaaatttaaaaatagagataaatctttgctatttgttcccttt
ttcgtttcaggttttcctgactttgattttttagagaaatttttatttaaaaataaagat
aagattgatatacttgagcttggagttcctttttcggatcctgtagctgatggacctatt
ttgcaggagataaattatagagcaatggtaaaaggtgtaaacttaaacaatactcttgac
tggcttttggattcgggaatcacaaaaaagatcgatgttattcttcttctttattttaat
ctaatccaaaacaagcttgaggaaaaattgaaaagatttaaggaagtagggattaaagga
ttagtaatacctgatttgccattggaagaagcagaaaaacttatccctttatttaacgaa
cataaccttgatcttattctttttatatctcctactactagggaagaaagaattaggaag
atcttagatatagctccaagttttttgtattgtatatcggttaaaggagtaacgggtgaa
agggacagacttcccgaagaaggagtagcttttataagtagagttaagaaagagactaat
aagcctcttgtttgggggtttggtttgggtagtagttatcagataaattctcttaagggg
ttggtagatggtgtgattgtaggtagtgcaataggtaaaaggcttttaaataatgaggat
attcaggattactttgatgagttatataaagctacgctttga

DBGET integrated database retrieval system