KEGG   Dictyoglomus thermophilum: DICTH_0594Help
Entry
DICTH_0594        CDS       T00774                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(598322..600202)
Genome map
AA seq 626 aa AA seqDB search
MIREEISYLVLPKEVENILLSCKKIIIPESREHFLELALGGKNNMEFEVKYEVPGKGEVV
EAIITRAKNGIVVNYTDPYMRRRDPDSLVIGDEGDTDKPTFKERFGEDFDTLREKTFNWL
KEQELIVMPFMAGGYELGYPSLLIAPSNAGFFAWALADIQGFIPKSQLRDNFEPIAIVYV
APPFRHTHFSGKQIVVHYRSDGRHEVFSYNLYPGPSAKKGVYGVLLNIGEMEGWITAHAS
TVKIVTPYDNELVILHEGASGGGKSEMIQQMHREKDNRILVGENIVTGEKYYIEIKESCE
IFPVTDDMALCHPRLQNGSGKMVIKDAEQGWFVRVDQIKRYGVDPQLESITIHPPEPLIF
LNIEGHPGATALIWEHTMDEPGKPCPNPRVILPRRFVPNIIDEPVEVDVRSFGFRTPPCT
KDKPTYGIVGLFHVLPPALAWLWRLVSPRGYDNPSITSGDLMSSEGVGSYWPFATGKMVK
HANLLLQQILDYPRTQYILIPNQYIGAYRVGFMPEWIVREYLAKRGSARIKPDNLKPARC
SLLGFALETLKVEGHYIPKALLQVDQQPEVGPEAYDKGAEMLKAFFKKELQKFISLDLDP
LGKRIIECCLEDGTLEDYIKLIPPRR
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgataagagaagaaatttcatacttagtcctaccaaaagaagtagaaaacattcttctt
tcttgtaaaaaaattataatccccgaaagtagggaacattttttagaacttgccttaggt
ggaaaaaacaatatggaatttgaggtaaaatatgaggtcccaggaaagggagaagtggtt
gaagccataataacaagagcaaaaaatggtatagtggtaaactatacagatccttacatg
agaagacgtgaccctgatagtttggtaataggagacgagggagacactgataaacccact
tttaaggaaagatttggcgaagattttgatactttaagagaaaagacctttaactggtta
aaagagcaagaactaattgtaatgccttttatggctggaggatatgaattaggatatcca
tctctgttaattgctccttctaacgcaggattttttgcttgggctcttgcagatattcaa
ggatttatacctaaaagtcaattgagagataactttgaacctatagctattgtttatgta
gctcctcccttcagacatactcatttttcaggtaaacagatagtagtacactatagatct
gatggaaggcacgaggtattctcttacaatctgtatccagggccaagtgctaaaaaaggt
gtctatggtgtgcttttaaatataggcgagatggaaggctggattactgcccatgcctct
acagtcaaaatcgtcactccttacgataacgagttagtaatactgcacgaaggagcaagt
ggcggtggaaaaagtgaaatgattcaacaaatgcacagggagaaggataatagaatacta
gtaggagaaaacatcgttacgggagaaaagtactacattgagataaaagaatcatgtgaa
atattccctgtaaccgatgatatggctttatgccacccacgtcttcaaaatggaagtggt
aaaatggttataaaagacgcagaacagggatggtttgtaagagttgaccagataaaaaga
tatggagtagatccccaacttgaatccattacaattcatccaccagagcctcttatattc
ctaaatattgaagggcatcctggagccacagccctaatatgggaacatactatggacgaa
ccaggaaaaccttgtcctaatccaagagtaatattaccgagaagatttgtacctaatatt
atagatgagcccgtagaagtagacgttagaagttttggctttagaactccaccttgtaca
aaagacaaaccaacttacggaattgttggactgttccatgtacttccacctgccttagcc
tggctatggagattagtaagtccaagaggatacgataatcccagcataaccagtggcgat
ctaatgagtagtgagggtgtaggttcatattggccttttgcaacaggaaagatggtaaaa
catgctaatctcttactacaacaaattctagattatccacgtactcagtacatacttatt
cctaaccaatatattggtgcttatagagttggttttatgccagaatggatagtaagagag
tatctggcaaaaagaggtagcgccagaattaaacctgataatctaaaaccagcaagatgt
tcattacttggatttgctcttgaaactctaaaagtagaaggtcattacattcctaaagct
ctccttcaagtagatcaacagccagaagtaggccctgaagcttatgataaaggagcagaa
atgcttaaagcatttttcaaaaaggaactacaaaagttcatatctttagatcttgacccc
ttaggcaagagaattatagagtgttgccttgaagatggaaccttagaagactatataaaa
ctcattcctcctcgaagataa

DBGET integrated database retrieval system