KEGG   Dictyoglomus thermophilum: DICTH_0595Help
Entry
DICTH_0595        CDS       T00774                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(601704..602387)
Genome map
AA seq 227 aa AA seqDB search
MALLREEDRQYLENLFKENLKDKVKIILFSDKAAGSKLVVPGRVECPYCQQTREILEELV
SLSDKLELEIHDFLTDEIIAKKYNVDKIPAILFEKNNNVLGVRYFGIPSGYEFSSLIEDI
LDISRGETQLSPTTKAFLATVNKPVHIQVFVTPTCPYCPRAVRLAHQFAMENPLITADMI
EAIEFPHLAEKYNVTGVPKTIINEKVEIEGAVPENIFLEYFKSALKD
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggctttattaagagaagaggatcgtcaatatttagaaaatctatttaaagaaaacctt
aaagacaaagtaaaaattatactcttcagtgacaaagcagcaggaagtaagctggttgtt
cctgggagagtagaatgtccttactgccagcaaacaagggaaatcttagaagaacttgta
tccctttcggacaagctagaacttgaaattcacgattttctaaccgatgagataattgct
aaaaagtataatgtggataagatacctgcaattctttttgaaaaaaataacaacgtcctt
ggtgtgaggtattttggtatcccttctggatatgaattctcaagtttaatagaagacatc
ttggacatatcccgtggagaaactcaactttccccaaccacaaaagctttccttgctact
gtaaacaaaccagtacatatacaagtattcgttactcctacatgtccatactgtccaaga
gcagtgagactcgcccaccaatttgccatggaaaacccattaattactgcagacatgata
gaagctatagaatttccacatcttgctgagaagtacaatgtaactggagttcctaaaaca
ataataaatgagaaagtagaaattgaaggagctgtacccgagaacatattccttgaatac
tttaaatctgctttaaaagactaa

DBGET integrated database retrieval system