KEGG   Dictyoglomus thermophilum: DICTH_0603Help
Entry
DICTH_0603        CDS       T00774                                 

Definition
(GenBank) YqeZ
  KO
K07403  
membrane-bound serine protease (ClpP class)
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(607811..609082)
Genome map
AA seq 423 aa AA seqDB search
MKKIFITIFLLFLILSSIYAQNQNVYIIPIKGTIELGLASFVERSIREHPNAKAFIFEID
TFGGRVDAAIKIRDTILATPTLTIAFIKDRAWSAGALIALSCEKIVISPSGSIGAAEPRP
ADEKTISALKAEFESTAKKRNRNPKIAAAMVDADEVIPGLKQKGKILTLYAEEAKKWKIA
DEILENTDSVIKFFNLEKGKIIELQPNWAENFVRFITDPTVSSIILTVGMLSLYVAIFTP
GLGVPELLALVCLGLFFGGHYLAGLAGLEPVILFLLGLILIFIEMHTPGFGIPGIAGSIS
VFLSIYWTIVQKGGTLQALLTGILVVLSLIIFLAIYLPKSRVWIKFGLPESQKKDLGYTA
FQERKDLIGKKGKTITMLRPTGIIEIEGEKFEAYSESEFIEPSEEVIVFKVEGNKIFVRR
SEK
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaatctttataactatttttcttttgtttttaatactatcctccatatatgct
caaaatcaaaatgtttacataataccaataaagggaactatcgaactcggtcttgcctct
tttgttgaaagaagtataagagaacaccctaatgcaaaagcctttatttttgaaatagac
acttttggaggcagagtagacgcagctatcaaaataagagatactatattggctaccccc
actttaactatcgcttttataaaagatagagcctggtctgcaggggccttaatagcatta
tcttgcgaaaagatagttatttctccttcaggtagtattggagctgcagaacctcgtcca
gccgatgaaaaaactatctcagctttaaaagctgaatttgaaagtacagcaaaaaagaga
aatagaaaccccaaaattgcagctgcaatggtagatgctgatgaggtaattccaggttta
aaacaaaaaggaaagattttaactctatacgcagaagaggctaaaaaatggaaaattgct
gatgaaatattagaaaacacagactcagtaataaaattctttaacttagaaaagggaaaa
atcatagaattacaacctaattgggctgaaaacttcgtaagatttataactgaccctact
gtatcaagcattatactaacagtaggaatgctttccttatatgtagccatatttactcct
ggtcttggtgtccctgaactcttagctttagtgtgtttaggtttattttttggaggacat
tatcttgccggacttgcaggcttagaaccagtaattttattccttcttgggcttatctta
atttttatagaaatgcatacgccaggatttggaattcctggaatagcaggaagtatctcg
gtatttctcagtatatactggacaatagtacaaaaaggaggtacccttcaagcattactc
actggaatattagtagtcctttcacttataatattcctagcaatttatctaccaaaaagt
cgtgtatggataaagtttggacttcctgagagtcaaaagaaagatttaggctatactgct
ttccaagagagaaaagatttaattggaaaaaaaggcaaaactattactatgctacgtcct
acaggaattatagaaattgaaggagaaaaattcgaggcttattcggaatcagaatttatt
gaacctagcgaagaagttatagtcttcaaagttgagggaaataaaatctttgtaaggagg
agtgaaaaatga

DBGET integrated database retrieval system