KEGG   Dictyoglomus thermophilum: DICTH_0628Help
Entry
DICTH_0628        CDS       T00774                                 

Definition
(GenBank) DegV family protein
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
633735..634586
Genome map
AA seq 283 aa AA seqDB search
MIKIVTDSTAALPEEYVKRYDITVVPLKVAFGDEVYRDGVDITPEIFFKKVKESSIFPKT
SQPSVEEFYQAYKNIFDKYPDTEAIISIHISAKLSGTVGSANAARELLPQKDKIFVIDSK
LTELALGVVVIELAKAVEKGAKVDDLIALAEKMHLHSSIKFTVDTLEYLYRGGRIGAAQA
WMGSILQIKPILELRDGAIEPVERVRTKQKVKSRIIELTKEYAGSDPVKIAIAYSDNYEE
VLEVAQEVKNSLNITDFYIGPFSCTILSHIGPGSWGIIVFKEV
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaattgtgactgatagtactgctgctcttcctgaagagtatgtaaagagatat
gatataacagtggttcctttaaaggttgcttttggggatgaagtttacagagacggtgtg
gatattactcctgagattttctttaaaaaagtaaaggagagttcaatttttccaaagaca
tcacagccgtcggtagaagaattttatcaagcttataaaaatatctttgataaatatccg
gacacggaggctataatttctattcatatttcggcgaaattaagtggaactgtgggttct
gcaaatgctgcaagagagcttttaccacaaaaggataagatatttgtcattgattcgaag
ttaactgagcttgctcttggagtagttgtcattgaacttgcaaaggcagtcgaaaaagga
gcaaaagtggatgatctcatagctcttgctgagaagatgcatctacatagcagtataaaa
tttactgtggatactttagagtatttatatagaggtggtagaattggagcagcgcaggct
tggatgggaagtattttacaaatcaaacctattttagagcttagagatggagctatagag
ccagtagaaagggtaaggactaaacaaaaagttaaatcaagaattattgaacttactaag
gaatatgctggaagcgatccggttaagattgctattgcttattcagataattatgaagag
gttttagaagtagcacaagaggtaaagaacagtttaaatataactgatttttatataggg
ccttttagttgtactattctttctcatattgggccaggctcttggggaataatagttttt
aaagaagtttag

DBGET integrated database retrieval system