KEGG   Dictyoglomus thermophilum: DICTH_0629Help
Entry
DICTH_0629        CDS       T00774                                 

Definition
(GenBank) single-stranded nucleic acid binding R3H
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
634598..636145
Genome map
AA seq 515 aa AA seqDB search
MNKLLQQIVDDLDKFLAIFPSDIKSRLEQDPDIKDLIEVVLDLGREIEARFYKKTVVFEG
RFTTEEDLNYIIARVGEFSGDKRAGIERTLHRISAIENRHGRIIGLTCRVGRAVLGTVDI
IRDVIETGKNILLLGRPGVGKTTLLRETARVLADELGKRVIIIDTSNEIGGDGDIPHPAI
GRARRMQVPNPAKQHDVMIEAVENHMPEVIVIDEIGTELEAKAARTIAERGVQLIGTAHG
ITLQNLLLNPTLSDLVGGIQVVTLSDEEAKRRGTQKTVLERKAPPTFQVVIEIQERDRLA
IHHDVAKTVDALLRGYIIKPEIRLRTPEGEVKKVEAPTIEPSEEEEEVSVFGKPEREKRT
EPLKIFPYGISRNRLEKAIRNLGVPAFVVKNLSEASCLLILKAHQKRAKDLLKEAEKKGI
KIAVLRSNTVTQIERFLSEEFGISVGTSKSDAEEEALREAQEGIEYVLTHDEPYELSPQP
AYIRRLQHQLIQQYGLYSESVGVEPFRKVRIYPSH
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgaataagttgttacagcaaatagtggatgatttagataagttcttagccatatttcca
agtgacatcaaaagtaggttagaacaagatcctgatataaaggatctcatagaggttgtt
cttgatcttggaagggagattgaggcaagattttataagaaaactgttgtttttgagggg
aggtttaccaccgaagaagatttaaattatattattgcaagagttggagaattcagtggc
gacaaaagagctggaatagaaagaactcttcatagaatttctgctatagagaataggcat
ggtagaataattggattaacttgtagagtaggaagagcagtgttaggaacggtcgacata
ataagagacgtgattgaaactggaaagaatattcttcttttaggtaggcctggtgttggt
aaaacaactcttttaagagaaacagcaagagttcttgctgatgagcttggtaagagagta
attattatcgatacctctaacgagattggtggtgatggagatattcctcatcctgctata
ggtagggcaagaaggatgcaagttccaaatccggcaaaacaacatgatgtgatgattgaa
gcggtagaaaatcatatgcctgaagttattgtaattgatgaaattggaaccgaacttgag
gcaaaggctgcaagaactattgctgaaagaggtgtgcagttgattggtactgctcacggt
ataactcttcagaatttacttcttaatcctacgctctcggatcttgtgggagggattcag
gtagtaacattgagcgatgaagaagcaaaaagaagaggtactcagaagactgttcttgaa
agaaaagctcctccgacctttcaagtggttatagaaattcaggaaagagatagacttgct
attcatcatgatgtggcaaaaactgttgatgccctattaagaggatacattataaaacct
gagataagacttagaactcctgaaggagaggtaaaaaaagttgaagctcctactattgag
ccttcagaagaagaggaagaagtatcggttttcggaaagcctgaaagggagaagaggaca
gagcctttgaaaatattcccctatggaataagcaggaatagacttgaaaaagcaatacgt
aatttaggggttcctgcttttgtagtgaaaaatctttccgaagctagctgcctcttgata
ttgaaagcacatcagaaaagagcaaaagatcttttgaaagaagcagaaaagaagggtatt
aagattgccgttttaagaagtaacactgttactcagatagagagatttttgagcgaggag
tttggaataagtgtaggtacgagtaagagtgatgcagaggaggaggctctcagagaagct
caagaaggtattgagtatgtgttgactcatgatgaaccttatgaattatcacctcagcct
gcttatataagaagattacaacatcagctcattcagcagtatggattgtattcggaaagt
gtaggagtagagcctttccgtaaggtaaggatatatccatctcattaa

DBGET integrated database retrieval system