KEGG   Dictyoglomus thermophilum: DICTH_0629Help
Entry
DICTH_0629        CDS       T00774                                 

Definition
(GenBank) single-stranded nucleic acid binding R3H
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: R3H AAA AAA_18 AAA_30 NTPase_1 AAA_24 AAA_16 AAA_25 AAA_22 AAA_5 AAA_19 ABC_tran CbiA ATPase ATPase_2 NACHT T2SSE IstB_IS21 AAA_31 TsaE AAA_33 RuvB_N cobW MMR_HSR1 SRP54 RsgA_GTPase Mg_chelatase FemAB TrwB_AAD_bind AAA_14 AAA_29
Motif
Other DBs
NCBI-ProteinID: ACI20126
UniProt: B5YD94
Position
634598..636145
Genome map
AA seq 515 aa AA seqDB search
MNKLLQQIVDDLDKFLAIFPSDIKSRLEQDPDIKDLIEVVLDLGREIEARFYKKTVVFEG
RFTTEEDLNYIIARVGEFSGDKRAGIERTLHRISAIENRHGRIIGLTCRVGRAVLGTVDI
IRDVIETGKNILLLGRPGVGKTTLLRETARVLADELGKRVIIIDTSNEIGGDGDIPHPAI
GRARRMQVPNPAKQHDVMIEAVENHMPEVIVIDEIGTELEAKAARTIAERGVQLIGTAHG
ITLQNLLLNPTLSDLVGGIQVVTLSDEEAKRRGTQKTVLERKAPPTFQVVIEIQERDRLA
IHHDVAKTVDALLRGYIIKPEIRLRTPEGEVKKVEAPTIEPSEEEEEVSVFGKPEREKRT
EPLKIFPYGISRNRLEKAIRNLGVPAFVVKNLSEASCLLILKAHQKRAKDLLKEAEKKGI
KIAVLRSNTVTQIERFLSEEFGISVGTSKSDAEEEALREAQEGIEYVLTHDEPYELSPQP
AYIRRLQHQLIQQYGLYSESVGVEPFRKVRIYPSH
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgaataagttgttacagcaaatagtggatgatttagataagttcttagccatatttcca
agtgacatcaaaagtaggttagaacaagatcctgatataaaggatctcatagaggttgtt
cttgatcttggaagggagattgaggcaagattttataagaaaactgttgtttttgagggg
aggtttaccaccgaagaagatttaaattatattattgcaagagttggagaattcagtggc
gacaaaagagctggaatagaaagaactcttcatagaatttctgctatagagaataggcat
ggtagaataattggattaacttgtagagtaggaagagcagtgttaggaacggtcgacata
ataagagacgtgattgaaactggaaagaatattcttcttttaggtaggcctggtgttggt
aaaacaactcttttaagagaaacagcaagagttcttgctgatgagcttggtaagagagta
attattatcgatacctctaacgagattggtggtgatggagatattcctcatcctgctata
ggtagggcaagaaggatgcaagttccaaatccggcaaaacaacatgatgtgatgattgaa
gcggtagaaaatcatatgcctgaagttattgtaattgatgaaattggaaccgaacttgag
gcaaaggctgcaagaactattgctgaaagaggtgtgcagttgattggtactgctcacggt
ataactcttcagaatttacttcttaatcctacgctctcggatcttgtgggagggattcag
gtagtaacattgagcgatgaagaagcaaaaagaagaggtactcagaagactgttcttgaa
agaaaagctcctccgacctttcaagtggttatagaaattcaggaaagagatagacttgct
attcatcatgatgtggcaaaaactgttgatgccctattaagaggatacattataaaacct
gagataagacttagaactcctgaaggagaggtaaaaaaagttgaagctcctactattgag
ccttcagaagaagaggaagaagtatcggttttcggaaagcctgaaagggagaagaggaca
gagcctttgaaaatattcccctatggaataagcaggaatagacttgaaaaagcaatacgt
aatttaggggttcctgcttttgtagtgaaaaatctttccgaagctagctgcctcttgata
ttgaaagcacatcagaaaagagcaaaagatcttttgaaagaagcagaaaagaagggtatt
aagattgccgttttaagaagtaacactgttactcagatagagagatttttgagcgaggag
tttggaataagtgtaggtacgagtaagagtgatgcagaggaggaggctctcagagaagct
caagaaggtattgagtatgtgttgactcatgatgaaccttatgaattatcacctcagcct
gcttatataagaagattacaacatcagctcattcagcagtatggattgtattcggaaagt
gtaggagtagagcctttccgtaaggtaaggatatatccatctcattaa

DBGET integrated database retrieval system