KEGG   Dictyoglomus thermophilum: DICTH_0631Help
Entry
DICTH_0631        CDS       T00774                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
636777..637103
Genome map
AA seq 108 aa AA seqDB search
MKLVFAIIQEEDWKKVREIFIEHNLSLTFFKSKGGFLEEASITLMTVVEDDKFEEVLSIL
RENCKEREKMIIPPLPSVELLRTVPMPVKIKVGGAVVFAVDVSYFEKI
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagtttttgcaattatccaggaggaagactggaagaaggtaagagaaattttc
atagagcataatttatctcttaccttcttcaaaagtaaaggtggttttttggaggaagct
tctattacattgatgacagtagtagaggatgataagtttgaagaggtcttatctatttta
agagaaaattgtaaggaaagagaaaaaatgattattcctcctcttccatcggtagagctc
ttaagaactgtacctatgcctgttaaaataaaagtaggcggagcagtagtatttgcagtg
gatgtaagctattttgagaaaatataa

DBGET integrated database retrieval system