KEGG   Dictyoglomus thermophilum: DICTH_0632Help
Entry
DICTH_0632        CDS       T00774                                 

Definition
(GenBank) DNA polymerase III subunit gamma/tau
  KO
K02341  DNA polymerase III subunit delta' [EC:2.7.7.7]
Organism
dth  Dictyoglomus thermophilum
Pathway
dth00230  Purine metabolism
dth00240  Pyrimidine metabolism
dth01100  Metabolic pathways
dth03030  DNA replication
dth03430  Mismatch repair
dth03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    DICTH_0632
   00240 Pyrimidine metabolism
    DICTH_0632
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    DICTH_0632
   03430 Mismatch repair
    DICTH_0632
   03440 Homologous recombination
    DICTH_0632
Enzymes [BR:dth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     DICTH_0632
DNA replication proteins [BR:dth03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     DICTH_0632
DNA repair and recombination proteins [BR:dth03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     DICTH_0632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_delta2 AAA ResIII DNA_pol3_delta TIP49 AAA_22
Motif
Other DBs
NCBI-ProteinID: ACI18709
UniProt: B5YD97
Position
637106..638086
Genome map
AA seq 326 aa AA seqDB search
MAFKEIVGQKQAIEVLRRAINENKLSQTYLFVGPEGVGKRLTAISFVQALNCKVEPLEGC
GECDICKSIEKLSYPDLFYLKPEGQWYKIQQIRDIRKEAYVKPYISNWKVFILDDAHQLR
AEGANALLKILEEPPEHTLFILIAYRPELLLPTIISRSQIISFSYLSYDEVWQIIKDKVS
EDKLEILVNLSQGSVGKALFWGEENNWTKRIELFKYLTLLKKDRPYSPFELVDFLVEEKD
DEKIINLLELVLFWWRDLLLWKLTEDEKYIMQKDFLPEIARKAQEYSVSDLRNFFRLTQD
AIRGIRNNANLLLTLETLFLRVGMSS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcctttaaagagatagttggacaaaaacaagctatagaggtgttaagaagagctatc
aatgaaaataaattatcccaaacttatctttttgtgggtcctgaaggtgttgggaaaaga
ttaactgctatctcttttgttcaagctttaaattgtaaggtagaaccccttgaaggatgt
ggtgaatgcgatatttgtaagagtatagaaaaactttcttatcctgatttattttacctt
aaacctgaggggcaatggtataagatacagcaaattagagatattagaaaagaagcctat
gttaagccatacattagtaattggaaagtatttatcttagatgatgctcatcagctaaga
gcggaaggggctaatgcccttttgaaaatattagaagagcctccagaacataccttgttt
attttaatagcttatagacctgagttactattgccaacaattatttcaagaagtcaaata
ataagtttttcttatttgagttatgatgaggtttggcaaataataaaggataaggtttcg
gaggataaattagagattctggtgaatttatcgcaggggagtgttggaaaggctcttttt
tggggtgaggagaataattggactaagaggatagaattatttaaatatttaactcttctt
aagaaggataggccatattctccttttgagcttgtggattttttagtagaggagaaagat
gacgaaaagattataaatcttcttgagcttgttcttttctggtggagagatctgcttttg
tggaagctcacggaagatgagaagtatattatgcagaaagatttcttaccagaaatagcg
agaaaggcgcaagaatattcggtctcagatctgagaaactttttcaggttaactcaggat
gctataagaggtattagaaataatgctaatttattgttaacattagaaactctattttta
agggtgggtatgagctcatga

DBGET integrated database retrieval system