KEGG   Dictyoglomus thermophilum: DICTH_0634Help
Entry
DICTH_0634        CDS       T00774                                 

Definition
(GenBank) hypothetical protein
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
638996..639769
Genome map
AA seq 257 aa AA seqDB search
MDYFEEIKIFFWRRGYQIDECCQKDRIVLPKNTSLESDYFSFLSHYRFRRLLSDIIHSQD
NGKVLIDRLLSRWKLEEIKEYWDFLIKSGIINLIGNDYYFSYPYIDNFGETLEWYISELL
RKEFKMPTIWGVKIRELRGGGDFDVLSILEGSLLYIECKTSPPNNVRLREMWEFLRRREE
LKPKITIFFIDTTLKIERNIIENIKYLLDRRFAKGKSNISLKLKEGIYAFDKSLYIMQSK
GDLIKNFQIVFRNFFNG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
gtggattattttgaggagattaaaatattcttttggagaagaggatatcaaattgacgag
tgttgtcaaaaagatagaatagttttacccaagaacacatctttggagagtgattatttt
agctttctttctcattacagatttagaagactcttaagtgatataatccattcgcaagat
aacggaaaagttcttattgataggttattgtctcgttggaagttagaggaaataaaagaa
tattgggactttttaatcaaaagtggaattataaatttaattgggaatgactattatttt
tcttatccttatattgacaattttggagaaacccttgaatggtatatatccgagcttttg
agaaaagaatttaaaatgcctacgatttggggcgtaaagattagagagttaaggggaggg
ggagattttgatgttctttctatccttgaaggtagtcttttatatatagagtgtaaaacc
agtcctcctaataatgtaagattaagggaaatgtgggaatttcttaggcgaagagaagaa
ttgaaacctaaaattactatattttttattgatactacactcaagatagaaagaaatata
attgaaaatataaaatatcttcttgataggagatttgcaaaaggtaaaagtaatataagc
ctaaaactaaaagaagggatatatgcatttgataaaagtttatatataatgcaaagtaaa
ggcgaccttattaagaattttcaaatagtttttaggaatttttttaatggatag

DBGET integrated database retrieval system