KEGG   Dictyoglomus thermophilum: DICTH_0637Help
Entry
DICTH_0637        CDS       T00774                                 

Definition
(GenBank) ribokinase:Carbohydrate kinase, PfkB
  KO
K00847  
fructokinase [EC:2.7.1.4]
Organism
dth  Dictyoglomus thermophilum
Pathway
Fructose and mannose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    DICTH_0637
   00500 Starch and sucrose metabolism
    DICTH_0637
   00520 Amino sugar and nucleotide sugar metabolism
    DICTH_0637
Enzymes [BR:dth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     DICTH_0637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
643928..644875
Genome map
AA seq 315 aa AA seqDB search
MIIVGGEALIDFTPIEINGEIAYIPKEGGSPYNVAITLGRLGAPCGFFGKISYDFFGEML
IEKLKKNHVDISLVLRSEKNTTLAFVILREGEPHFIFYGENTADVSLEEKDIPLIDPEKV
ELIHFGSISMIREPGCFVLEKMMTQNHGKVLISFDPNIRPNLIRDKNDYLRKFEAWLKTI
DILKASIADIKWLYETESMDEIARYFLEKGVKIFLLTLGKEGSIGYTKFFSAFSKGKEVK
VVDTVGAGDAFMGGFLYYLNSIGKLNKNFLENVTKTELENALDFSNTVSALTCTKKGAEP
PYLAEVENFMGKRYY
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgattattgtgggtggtgaagcacttatagattttactcctatagagataaatggtgaa
atagcatatatacctaaagaaggtggatcgccatataatgtagcaattactttgggaaga
ttgggagcaccttgtggtttttttggtaagatatcttacgatttttttggagagatgttg
attgaaaaactgaagaaaaatcacgtagatatttccttagtattaagatcagagaagaat
actactcttgcttttgttatcttgagagaaggagagcctcattttatattttacggagaa
aatactgctgatgtctctttagaagaaaaggatatacccttaatagatccagaaaaagtt
gagcttattcattttggctctatatctatgataagagaaccagggtgttttgtattagag
aaaatgatgactcaaaatcatgggaaggtcttaatttcctttgatcctaatataagacct
aatttaataagggataagaatgattacttaagaaagtttgaggcttggcttaaaactata
gatattctaaaagcaagtattgcagatattaaatggctttatgagacagagagtatggat
gaaattgccaggtattttttagaaaaaggtgtaaaaatatttcttttgactttgggaaag
gaaggatcaatagggtatactaaattcttttctgctttttctaagggaaaagaggtgaaa
gttgttgatacagtaggagcaggcgatgcttttatgggaggattcttatattatttgaat
tctataggaaaattgaataaaaattttttagaaaatgtaactaagacagaacttgaaaat
gccttagatttttccaatacagtttcagctttaacctgtactaaaaaaggagccgagcca
ccatatttggcagaggttgaaaattttatgggtaaaaggtattattga

DBGET integrated database retrieval system