KEGG   Dictyoglomus thermophilum: DICTH_0638Help
Entry
DICTH_0638        CDS       T00774                                 

Definition
(GenBank) membrane-associated zinc metalloprotease, putative
  KO
K11749  
regulator of sigma E protease [EC:3.4.24.-]
Organism
dth  Dictyoglomus thermophilum
Pathway
Quorum sensing
Brite
KEGG Orthology (KO) [BR:dth00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    DICTH_0638
Enzymes [BR:dth01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     DICTH_0638
Peptidases [BR:dth01002]
 Metallo Peptidases
  Family M50: S2P protease family
   DICTH_0638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
644919..645965
Genome map
AA seq 348 aa AA seqDB search
MELILFLILFGLLTIPHEFGHFIFAKIFGVKVYEYAIGFGPKILEIKGKETRFVLRLIPI
GGFVKMAGVDDINLPEFEEVPENRRFYRKAPWQRFLILFAGSFMNFVFAIILFISIFLIG
IPQPIPVVDKVLENKPASMAGIMPGDRLLYINGQKIEDISDAVRLITGSIKAPGEEKFIE
VTLERDGNILTFRVKPEWSEERKGGVIGIVFKTVPKKYSLPASVKNGILMFVNALLLIFY
VFKALFSGAQGVSITGPIGIAKMTGEVASMGLIYYLNFIALLSVQIGIFNLLPIPALDGG
RILFIIIEKVRGKPIETSKEEIIHWVGFLILLFLMLLVTFFDILNLRK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggagttaatactttttcttatactgtttggcttgctcactatacctcatgaatttgga
cattttatttttgcaaagatttttggggttaaggtatatgagtacgctataggttttgga
cctaaaatcttagaaataaaagggaaagaaacaagatttgtactaagacttattccaatt
ggtggttttgtaaaaatggcaggagttgacgatattaatcttccagaatttgaagaagtg
cctgagaatagaagattctatagaaaggctccttggcaaagatttttaattttatttgct
ggctcttttatgaattttgtttttgcgataatacttttcatatctatttttcttataggt
attcctcagcctattcctgtagtagataaagtattagaaaacaaaccagcgagtatggct
ggaattatgccgggagatagacttctatatataaatgggcaaaaaattgaagatatttct
gatgcagtcagattgattactggatctataaaagctcctggagaagaaaagtttatagaa
gttacgctggagagggatggaaatattttaaccttcagggtaaagcccgaatggagtgaa
gaacgaaaaggtggggtaataggtatagtatttaaaactgttcctaagaagtactctctt
cctgcctcggttaaaaatgggattttaatgtttgtaaatgcattgcttttgatattttat
gtttttaaggctttgtttagtggagctcaaggtgtttctattacaggccctattggaatt
gctaagatgacaggagaagtggcttctatggggctgatttattatctaaatttcattgct
ctattaagtgtacaaatcggaatctttaacttattgcctattcctgctcttgatggtgga
agaattctttttataataattgagaaggtaagaggtaaacctatagaaacaagcaaagag
gagataattcattgggttggcttcttaatattgctatttttaatgttacttgtgactttt
tttgatatactaaacttgagaaaatga

DBGET integrated database retrieval system