KEGG   Dictyoglomus thermophilum: DICTH_0640Help
Entry
DICTH_0640        CDS       T00774                                 

Definition
(GenBank) hdig/kh domain protein
  KO
K18682  
ribonucrease Y [EC:3.1.-.-]
Organism
dth  Dictyoglomus thermophilum
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:dth00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    DICTH_0640
Enzymes [BR:dth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     DICTH_0640
Messenger RNA biogenesis [BR:dth03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     DICTH_0640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
647067..648536
Genome map
AA seq 489 aa AA seqDB search
MGLGYFIRRYIESKTIQLVEKRAEEILKKAEEEAEEKKRSALLEAKEEIFKLRNEAEREI
RERRNELTNLERRILQREENLERKEEILANKEREINNRLESVKRLEEEAMNELQKIAQMT
KEEAKEILLKHVEEEIQKDIAIKIKEAEAKYKEMAEEKAREIITEAIQRCAVDHTVESTV
SVVSLPSEEMKGRIIGREGRNIRTFETLTGVDLIIDDTPEAVVLSSFDPVRREIARIALE
RLVKDGRIHPARIEEMVNKAKKEVENRIREEGERALIEVGIQNIHPDLVRTLGRLYYRTS
YGQNVLQHSIEVAKIAAIIAAELHMDVNLAKRAGLLHDIGKAIDYEVEGSHATLGAELLK
KYGEHPDIVHAVAAHHEEIPLVKPLDVIIQVADSISAVRPGARRESIEIYIKRLEKLEEI
AMSFPGVEKAYAIQAGREVRVLVSPEEVDDLAATRLAYQIAKKIEKEMEYPGQIKVTVIR
ETRAVEYAK
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
ttgggtttaggatattttattagaagatacatagagagcaaaactattcagctagttgag
aaaagggccgaggaaattctaaaaaaggccgaagaggaagcggaagaaaagaaaagaagt
gctcttcttgaagcaaaggaagagatatttaaattaagaaatgaagctgaaagagaaata
agagaaagaagaaacgaacttacaaatcttgaaagaagaattcttcagagggaagaaaat
ttagaaagaaaagaagagattcttgccaataaagagagagagataaataataggcttgaa
agtgtcaaaagattagaagaagaggcaatgaatgagcttcaaaagatagctcaaatgact
aaggaggaagcaaaagaaatattattaaaacatgttgaggaagaaattcagaaagatatt
gccataaaaataaaagaagcagaagctaaatataaggagatggcggaagaaaaagcaaga
gaaataataacagaggctatacaaaggtgtgctgtagatcatactgtagagtctaccgtt
tctgtagtaagtttacctagtgaggaaatgaaaggaagaattattggtagagaaggaaga
aatattagaacctttgaaacattgacaggagttgatttaattatagacgatactcctgag
gctgtagtgctttcttcttttgatccagtaaggagagaaattgcaaggattgctttagaa
aggttagtaaaagacggtagaattcatcctgcaagaatcgaggagatggtaaacaaagct
aaaaaagaagtagaaaacagaataagagaggaaggcgaaagagcactaatagaagtgggc
attcaaaatattcacccagatcttgtaagaactttaggaagactatattacagaactagt
tatggccaaaatgttttacaacattcaattgaagtggccaagattgcagctataattgct
gctgaactccatatggacgtaaatcttgccaagagggcaggtcttcttcatgatataggt
aaagcaattgattatgaggtagagggatctcacgccacattaggcgcagaacttttgaag
aaatatggtgaacatcctgatatagttcatgctgtggcagcccatcatgaggaaattccg
ttggttaagcctttagatgttataatacaagtagcagatagtatatcggctgtaagacca
ggagcaagaagagaaagcattgagatatatataaagagattagagaaattagaagaaatt
gctatgtcttttcctggggtagagaaagcttatgccattcaggcaggtagagaggttagg
gtacttgtaagtccagaggaagtagatgaccttgctgctacaagacttgcttatcagatc
gcaaaaaagattgagaaggaaatggaatatccagggcaaattaaggttactgtaattaga
gagacaagagctgtagagtacgcaaagtaa

DBGET integrated database retrieval system