KEGG   Dictyoglomus thermophilum: DICTH_0641Help
Entry
DICTH_0641        CDS       T00774                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09769  
uncharacterized protein
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
648539..649327
Genome map
AA seq 262 aa AA seqDB search
MNILFLGDIVGRIGRRGVGLLLPQIKKEYKIDLVLANIENAASGFGITESVLKELMDYGI
DAFTSGNHIWDKKEGIPLLDTYEKILRPANYPLGVPGRGYTVLTHLDKKVGIINIQGRVF
MEPIENPFHVVKNIVEEMKKDTKIIIVDIHAEATSEKIAMGYFLDGMVTAVVGTHTHVQT
ADERILPGGTGYITDLGMCGALDSVLGVEKEAVLKKFLLQIPQKFNVPEKGLFKMEGVII
EVEEESGKTKNIIRLQRRGEIK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacttttcttgggagatatagtaggaagaataggcagaaggggtgtaggcctt
cttctgcctcagataaagaaagaatataaaattgatcttgtgttggcaaacattgagaat
gctgcctcaggtttcggtattaccgaaagcgtacttaaagaattgatggactacggtata
gatgcatttactagtggaaatcatatttgggataaaaaagaaggcattcccttattagat
acctatgaaaaaatattaaggccagccaattatcctttaggagtacctggaagaggttat
actgttttaacacatttggacaaaaaagtgggtataattaatatacaaggaagagttttt
atggaacctattgagaatccctttcatgtggttaaaaatatagttgaagaaatgaaaaaa
gatactaaaataataatagtagatatacatgctgaagcaacgtcagaaaaaatagctatg
ggatattttttagatgggatggttacagctgttgtaggaacacatactcatgtgcagacg
gctgatgagaggattttgcctggggggacaggttatataacagatcttggtatgtgtggg
gctttagattcagttttaggtgttgagaaggaggctgttcttaaaaaatttcttctccaa
atacctcaaaaatttaatgtaccagagaaaggactttttaaaatggaaggggtgattata
gaggtagaagaagaaagtggaaaaacaaaaaacattataaggttacaaaggaggggagag
attaaataa

DBGET integrated database retrieval system