KEGG   Dictyoglomus thermophilum: DICTH_0648Help
Entry
DICTH_0648        CDS       T00774                                 

Definition
(GenBank) bifunctional methyltransferase
  KO
K02493  
release factor glutamine methyltransferase [EC:2.1.1.297]
Organism
dth  Dictyoglomus thermophilum
Brite
Enzymes [BR:dth01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.297  peptide chain release factor N5-glutamine methyltransferase
     DICTH_0648
Translation factors [BR:dth03012]
 Eukaryotic Type
  Release factors
   DICTH_0648
 Prokaryotic Type
   DICTH_0648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
653210..654034
Genome map
AA seq 274 aa AA seqDB search
MIWLKKEIEKFNPESAWLEAELLIAFVLNKERAFIYTIDFLEEEKIEEIKRLLDLRKKGI
PLNYIIKKKEFYNTEFFIEKGVLIPRNETEILIEVAKDSILREGYYRVAEVGVGSGNISI
TLAKEFENIKIYACDISPKAIKIARFNAEINKVSDKIEFFYGPFIYPLIYRNIDFEILLS
NPPYVASYEFPFLQKEVKREPWEALYGGWDGCEFYRTLFKILKDKGKKFVAILEISPFIY
KKVLNIVKRFFNNVIVESFEDSLGYKRVLRVVWQ
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
ttgatatggttgaagaaggaaatcgagaaatttaatcctgaatcagcatggttagaagct
gaactattaatagcttttgtattaaataaggaaagagcatttatatatacaattgatttt
ttagaagaagaaaaaatagaggaaatcaaaaggcttctagatttaagaaagaaaggtatt
cctttaaattatataattaagaaaaaagagttttacaataccgaattttttattgaaaaa
ggggtcctcataccaagaaatgaaacggaaatattaatagaagttgcaaaagattctatt
ttgagggaagggtattatagagtagcagaagttggggttggtagtggaaatatctctata
actcttgctaaggagtttgagaacataaagatatatgcttgtgatatatctccaaaggcc
ataaaaatagcaaggtttaatgctgagataaataaggtttctgataaaattgagttcttt
tatggaccatttatttatccccttatttatagaaatatcgattttgaaatcttattaagt
aatcctccttatgtggcttcttatgaatttccttttttgcaaaaggaagttaaaagagaa
ccatgggaagctctttatggaggatgggatggatgtgaattttatagaactctttttaag
attttgaaagataaagggaagaaatttgtggctatattggaaatatctccttttatatat
aaaaaagttttaaacattgtaaaaagattttttaataatgtaatagtagaatcttttgaa
gatagtttaggatataagagggtcttgagggtcgtatggcaatag

DBGET integrated database retrieval system