KEGG   Dictyoglomus thermophilum: DICTH_0652Help
Entry
DICTH_0652        CDS       T00774                                 

Gene name
glyA
Definition
(GenBank) serine hydroxymethyltransferase
  KO
K00600  
glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
dth  Dictyoglomus thermophilum
Pathway
Glycine, serine and threonine metabolism
Cyanoamino acid metabolism
Glyoxylate and dicarboxylate metabolism
One carbon pool by folate
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DICTH_0652 (glyA)
  Energy metabolism
   00680 Methane metabolism
    DICTH_0652 (glyA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DICTH_0652 (glyA)
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    DICTH_0652 (glyA)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    DICTH_0652 (glyA)
Enzymes [BR:dth01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     DICTH_0652 (glyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
655923..657167
Genome map
AA seq 414 aa AA seqDB search
MRYLPEVDPEIYEAIKSEEYREEYHLELIASENFVSRAVLEAQGSVLTNKYAEGYPGKRY
YGGCMYVDKVEDIARERVKTIYGAEHANVQPHSGSQANMAVYFVVLNPGDNVLGMNLAHG
GHLTHGSPVNFSGKLYNFYFYGVDRDTEMINYDSVWNLAKEVKPKLIVAGASAYPRIIDF
EKFAQIAEDVGAYFMVDMAHIAGLVAAGLHPSPVPYAHFVTSTTHKTLRGPRGGFILCKK
EFAKEIDKAVFPGIQGGPLMHVIAAKAVAFKEAMTPEFKEYQKQIILNAKAMAEELMRLG
YRLVSGGTDNHLMLVDLRDKGITGKEAEKALEEAGITVNKNAIPFDPQPPTVTSGIRIGT
PALTTRGMKEDEMRYVARLIHEVLSNFKDSKVKEKVKKEVEELCKQFPIYRKEN
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtgaggtatttaccagaggttgatcctgaaatttacgaggccattaagagtgaggagtat
agagaagaatatcatttagaacttattgcttctgaaaattttgtgagtagagctgtttta
gaggctcaaggttctgttcttaccaataaatatgctgaaggttatcccggaaagaggtat
tatggtggatgtatgtatgtggataaggtagaagatatagcaagggagagagtaaagaca
atatatggagctgagcatgctaatgtacaaccccattcaggtagccaagccaatatggct
gtttattttgtggttttaaatcctggagataatgttctggggatgaatcttgctcatggt
ggacacttgacgcatggaagtcctgttaatttttcaggaaagttatataatttttatttt
tatggcgtagatagagatacggaaatgataaattatgattcagtttggaacttggcaaaa
gaggtaaaacctaagctaatagttgctggtgcaagtgcttatccgagaattatagacttt
gaaaaatttgctcaaatagcagaggacgtaggtgcttatttcatggtagacatggctcat
atagctggacttgttgctgcaggattgcatccatctcctgttccttatgcgcattttgtt
acgagtactactcataaaaccttaagaggaccgaggggtggatttattttatgtaaaaaa
gaatttgccaaggaaattgacaaggcagtgttcccaggaattcaaggaggacccttgatg
cacgtgatagctgctaaggcagtagcctttaaagaagcaatgacccctgaatttaaggaa
tatcagaagcagataattttaaatgcaaaggctatggcagaagaacttatgagattagga
tatagacttgtgagtggtggaactgacaatcatctcatgctggtagatctgagggataag
ggaataactggaaaagaggcagagaaagctctggaggaggctggtataactgtgaataag
aatgcaataccttttgatcctcaacctcctacagtaactagtggaattaggataggtact
cctgcattaactactcgtggaatgaaagaagatgagatgagatatgtagcaaggttgatt
catgaggttctttcaaactttaaggatagtaaagtgaaagaaaaggttaaaaaagaagta
gaagaactttgtaaacaatttccaatttatagaaaggagaattaa

DBGET integrated database retrieval system