KEGG   Dictyoglomus thermophilum: DICTH_0655Help
Entry
DICTH_0655        CDS       T00774                                 

Definition
(GenBank) hypothetical protein
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
659081..660520
Genome map
AA seq 479 aa AA seqDB search
MKKVTKVLLIFTSILISLIFFVIITSPFWVKPLIYYILEKNFGNYIRAEDVRYIFPNKLQ
ISTLEIGDFASFSNASISLQNLIKLSPVNIELTKPKITVIHNEKGEWIFPQIPGIDASKP
GGSSSINVEIKAKIKDGIVIVRDLRIKKDIEIGKVNGDLSWKNQVITYSVSTFIDNQQIK
SYGNYDFSKEKGSLTFEFKNALANVWAPIFLSDIFQIEKGYFTGWINTQGEKSFWSATGE
INASKVEGKIASFSPKFADVSTKVKIEGENITILEGKGKLWEADIKFLGKVSPTPNLSIS
FGNLNLEKVDKEFFKNSINLKGNAKGEILISDSWEETVVKGYIVAEKGSIYNFVFDSIRV
NTDSKLPLISLEILGNLDVGSLTGKASLNLKSGFITLKLDANNIKVEKIAEVFNLPKMEG
KGDVIIEAKKDKKWKILVSGVIENGRLGEYSAENIKFNFENEDIDFNLPLGDSFFFQRG
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagtaactaaagttttattaatctttacttctatattaatctctttaatattt
tttgtaattattacctctcctttttgggtcaaaccattgatttattatattcttgagaag
aatttcgggaattatataagggctgaagatgtaaggtatatttttccaaataaactacaa
atatctactttagaaataggagattttgctagtttttctaatgcaagtatttctctgcaa
aatcttataaaactttctcctgttaatatagaattgactaagcctaaaataactgttatt
cacaatgaaaagggagaatggatttttcctcaaataccgggaattgatgcctctaagcct
ggaggctcaagcagtataaatgtagagataaaggcaaagattaaggatggaatagttatt
gttagagatttaaggattaagaaagatatagagatcggaaaggtaaatggtgacttgagt
tggaaaaaccaagttattacttatagtgtgtctacttttattgataatcaacaaataaaa
agttatggtaattatgacttctctaaggaaaaaggcagtctaacctttgagtttaagaat
gctttggctaatgtatgggctccaatttttctatctgatatatttcagatcgaaaaaggt
tattttactgggtggataaatactcagggggagaaaagtttttggtctgcaactggagaa
attaatgcatccaaagttgagggtaagattgcttcttttagtcctaaattcgcagatgtg
agtacaaaggtgaaaattgaaggagaaaatataacaatccttgaggggaaaggtaaactc
tgggaagcagatataaaatttttaggtaaagtttctcccacacctaacttaagtataagt
tttggaaatttaaatttagaaaaagtagataaagaatttttcaaaaatagtatcaattta
aaaggaaatgcaaaaggtgaaattcttatctctgattcttgggaagaaactgtggtaaaa
ggttatattgttgctgaaaaaggttctatatataattttgtttttgatagcataagggtg
aatacagactcaaaattgcctttgataagtttagagattttagggaatcttgatgttggt
tctttaacaggaaaggcctctttgaatttaaagagtggttttattaccttaaaacttgat
gctaataatatcaaggtagaaaagatagcagaggtctttaatcttcctaaaatggaggga
aaaggagacgttataatagaggccaagaaggataagaagtggaaaatattggtaagtggt
gttattgagaatggtaggctcggagaatactctgcagaaaatattaaatttaacttcgaa
aatgaagatatagacttcaatttaccccttggtgatagtttttttttccaaagaggttaa

DBGET integrated database retrieval system