KEGG   Dictyoglomus thermophilum: DICTH_0659Help
Entry
DICTH_0659        CDS       T00774                                 

Definition
(GenBank) cationic outer membrane protein, putative
  KO
K06142  
outer membrane protein
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
668357..668824
Genome map
AA seq 155 aa AA seqDB search
MKKYGFLALVLLISVAFVFVGLKIVGAQTQQPKIAYIDEDKLLRNYQPFMNAYNKYQQEY
QDRLNKIAEAQKAGKSQDEIKKLSDQYDKELEPYKQAVQKVLENLRKTLDGIFADLSKKE
GYIAVLTKSVQGQDVVIWGGVDITDKVIKILSGSK
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatatggatttttagctttagttctattaatctcagtagcctttgttttcgtt
ggtttaaagattgttggagcacaaactcaacagcccaagatagcctatattgatgaagat
aaacttcttagaaattatcagccctttatgaatgcttacaataagtatcaacaggaatac
caagataggttaaataagatagcagaggctcaaaaggcaggaaagtctcaggatgaaatt
aaaaagttgtcagatcagtatgataaagaattagaaccttacaaacaggcagtacagaag
gtattggaaaatttgagaaagactttagatggtatttttgctgatctttctaaaaaagag
ggatatatagcagttctaaccaagtccgttcaggggcaagatgtagttatatggggtggt
gttgatattacagataaagtcataaaaatactttcaggtagtaaatag

DBGET integrated database retrieval system