KEGG   Dictyoglomus thermophilum: DICTH_0665Help
Entry
DICTH_0665        CDS       T00774                                 

Gene name
lpxB
Definition
(GenBank) lipid-A-disaccharide synthase
  KO
K00748  
lipid-A-disaccharide synthase [EC:2.4.1.182]
Organism
dth  Dictyoglomus thermophilum
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    DICTH_0665 (lpxB)
Enzymes [BR:dth01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.182  lipid-A-disaccharide synthase
     DICTH_0665 (lpxB)
Glycosyltransferases [BR:dth01003]
 Polysaccharide
  Bacterial polysaccharide
   DICTH_0665 (lpxB)
Lipopolysaccharide biosynthesis proteins [BR:dth01005]
 Lipid A
  DICTH_0665 (lpxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
672283..673374
Genome map
AA seq 363 aa AA seqDB search
MKIFLSALEVSADIHGAKLINALKNKAKNIYFYGLGGERMKEEGMEVLYDVTQYSTVGFV
EPIPYIPKLLLVQERVKRIIKETKPDLIIFIDAQGFNLPLAKYAKKLGLKTIYYFAPQYW
LWGDKKKVKEVLDSLSYVIATFPQEYELYRSFGDNVVYYGHPLVDYLLPYKDLEREKNII
GLFPGSRIQEIKNLTPIFLEIADRLKVNGYRFVMPIASEKFSNLVFEYVRGKDHIELVSG
KESQKYLKISSLSLVASGTVTLEAAILKTPAMVFYKISPVTYHIAKRLVHYTFIALPNII
LNQMIYPEFIQKIDIEEVMTNIGRILKDDIYRKNLEDKLKELETKLGQPGVLDRISNFIL
EII
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatttctatcggcattagaggtttcggctgatattcatggtgcaaaattaata
aatgcattaaaaaacaaagctaaaaatatatatttctatggacttggtggagagaggatg
aaagaagaagggatggaagtattatacgacgtaactcaatatagtactgttggttttgta
gaacctattccttatattccaaaacttttattagttcaagaaagggttaaaaggataatt
aaggagacgaaacctgatttaataatttttatagatgctcagggatttaatttgcccctt
gcgaaatatgctaaaaaattaggtttgaaaacaatctattattttgctcctcaatattgg
ctttggggagataagaaaaaggtaaaagaggtcttagatagtctctcttatgttattgct
acttttcctcaagaatatgaattatatagaagctttggagacaatgtagtatattatggt
catcctctggtagattatctactgccctataaagatcttgaacgggaaaaaaatatcata
ggacttttcccaggcagtagaattcaagagattaaaaatttgactcctatttttttagag
atagctgatagattgaaagtaaatggatacagatttgtaatgcctattgcctctgaaaaa
ttctctaatttagtttttgagtatgtaaggggcaaagatcatatagaattagtttctgga
aaagagagtcagaaatatttaaagatttcatctttgagtcttgtggcttctggtactgta
accttagaggcagctattttaaaaactcctgctatggttttttataaaatctctcctgta
acttatcatattgctaaaagacttgttcactatacctttatagcactgcccaatattatt
cttaaccagatgatttacccggaatttattcagaagattgatatagaagaagtaatgact
aatataggaagaattttaaaggacgatatttatagaaaaaatttagaagataaattaaaa
gagttagagactaagttaggacaacctggagttttggacagaatttcaaactttatttta
gaaataatatga

DBGET integrated database retrieval system