KEGG   Dictyoglomus thermophilum: DICTH_0674Help
Entry
DICTH_0674        CDS       T00774                                 

Gene name
fusA_1
Definition
(GenBank) translation elongation factor G
  KO
K02355  elongation factor G
Organism
dth  Dictyoglomus thermophilum
Brite
Translation factors [BR:dth03012]
 Eukaryotic Type
  Elongation factors
   DICTH_0674 (fusA_1)
 Prokaryotic Type
   DICTH_0674 (fusA_1)
Mitochondrial biogenesis [BR:dth03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    DICTH_0674 (fusA_1)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    DICTH_0674 (fusA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EFG_IV GTP_EFTU EFG_C EFG_II GTP_EFTU_D2 MMR_HSR1 RF3_C ABC_tran AIG1 NB-ARC
Motif
Other DBs
NCBI-ProteinID: ACI18897
UniProt: B5YDD9
Position
681666..683753
Genome map
AA seq 695 aa AA seqDB search
MKYETENLRNVGLFGHGGAGKTSLAEAILYTAKVIDRMGRVENGNTVSDFEPEEIKRGIS
LSLSILPLEWKGKKINLIDTPGYADFIGEIISALRAVDSMLIVIDAISGIQVQTEKVWSM
GEGEKLPVAFVVNKLDRENSDFFEVVKSIQERFGSKAIPIYIPIGKEGNFNGVIDLLEGK
AYIYKDEKGDAEVSDIPSDLKSDYEKHRQQLIETIIEFDEELLQKYLEGEEISGDLILKT
LKEAFKNREIFPIFPVSSFKNIGVSKLLDAVVSFFPSPKERPALPIEDTKTGETKTISIG
EKNGLLAFVFKTSADPFVGKISYVRVISGVLRPDSNLFNVNKSVQEKIGGLFFQRGKNQE
PATEINAGDIGVITKLKETSTNETLGDKDNSVKVIPAEFPEPVFAVAVVPKSRADEDRMS
TAIARILDEDPTLRVQRNIETNETLIYGLGDSHLEVVVERMQRKFGVNVTLGTPQVAYRE
TIRATAKAEGKVKKQTGGRGQYGHVWLELEPLPRGAGFEFVDKIVGGVVPKNYIPAVEKG
VRETMEKGILAGYPIVDVRVTLFDGSYHEVDSSDMAFKIAASKAFKKGFLEAKPVLLEPI
MMVEITAPDEYTGDIISDLNGRRGKVTSIEALGKLQVIKALVPLAEMLRYSSVLKSITQG
RGSYSMKFSHYEEVPAKIQEEIIAKAKPRAEEEEE
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgaaactgaaaatttaagaaatgtaggactttttggacatgggggtgctgga
aagacaagtttagcggaggcgattctctatactgcaaaagtaattgataggatgggaaga
gtagagaatggaaacacggtatcggattttgagcctgaagagataaaaagaggtatttct
ctaagcttatctattttgcctttagagtggaagggcaaaaagataaacttgatagatact
ccaggatacgcagattttataggagaaattataagtgcattaagggctgtggatagtatg
cttattgtaatagatgcaatttcaggaatacaggttcaaactgagaaggtttggagtatg
ggtgaaggagaaaaacttcctgttgcttttgtagttaataaacttgacagggaaaactcg
gacttttttgaggtagttaaatctattcaggaaagatttggaagtaaagctattcctatt
tatattcccataggtaaagaaggtaattttaacggtgttattgatttgttagaaggcaag
gcttatatatataaagatgaaaaaggagatgctgaagtttcagatattccctctgattta
aaatctgattatgaaaagcacagacaacagcttattgagaccataatagagtttgatgaa
gaacttttacaaaagtacttagaaggagaagaaatatctggagatttaatccttaagact
ctaaaggaggcttttaaaaatagagagatcttccctattttccctgtatcctcttttaaa
aatattggagtttcaaaacttcttgatgctgtagtttccttcttcccaagccctaaagaa
cgtcctgctcttcctatagaagatacaaaaacaggagaaacaaagaccatatctattggt
gagaaaaatgggcttttagcttttgtatttaagacttccgctgatccctttgtgggtaag
ataagttatgtgagggttatttctggggttctaagaccagattctaacttattcaatgta
aataaaagtgtacaagagaagataggaggacttttcttccaaagaggaaaaaatcaagag
cctgctaccgagataaatgcaggcgatattggggttattactaaattaaaggaaacgtct
acaaacgaaactttgggagataaagataattcagtaaaagttattcctgctgaatttcct
gagccagtgtttgcagtagctgtagttcctaagtctagagcagacgaggatagaatgagt
actgctattgctagaattcttgatgaagatcctactttgagagttcagagaaatattgag
accaatgaaaccttaatctatggcttaggagattcgcatcttgaggtagtagttgaaaga
atgcagagaaagtttggtgttaatgtaactcttggtacccctcaagtggcgtatagggaa
accataagagctacagcaaaggcagaaggaaaggttaagaaacaaacaggtggaagaggc
caatatggacatgtatggctcgaacttgaacctcttccaaggggtgcaggatttgaattt
gtagataagattgtaggcggagtagtaccaaagaattatataccagcggtagaaaaaggt
gtaagagaaacgatggaaaaaggtattcttgctggatatcctattgtagatgttagggtg
acgttgtttgatggatcttatcatgaggtggactcctcagatatggcgtttaagattgca
gcttctaaagctttcaaaaaaggtttcttagaagccaaacctgttcttcttgaaccaata
atgatggtagagataacagctcccgatgaatatactggagatataattagtgatttaaac
ggtagaagaggaaaagtaacctctatagaggcgttaggcaaattgcaagtgataaaggct
cttgttcctcttgcagaaatgttaagatattcttccgtattaaagtctataactcaagga
agaggatcatattctatgaagttttcccattatgaagaagttcctgcaaaaatccaagag
gaaataattgctaaagctaaacctagagctgaagaagaagaggaatga

DBGET integrated database retrieval system