KEGG   Dictyoglomus thermophilum: DICTH_0684Help
Entry
DICTH_0684        CDS       T00774                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dth  Dictyoglomus thermophilum
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dth00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
691565..693049
Genome map
AA seq 494 aa AA seqDB search
MYILALDQGTTSSRAIIFDSLGNIIGVAQKEFPQIFPKPGWVEHNPWDIWNSQREVMFEA
IEKAKIKPKEISAIGVTNQRETTIVWDKDTGQPIHNAIVWQCRRTADYCERLKKDGLSEL
VKEKTGLVIDAYFSSPKIKWILDNVPEARKKAEQGKLLFGTVDTWLIWNLTGRKVHATDY
TNASRTMLFNIKNLDWDDELLEIMNIPRNMLPKPLPSSYFYGVCNIFEDAEIPITGIAGD
QQAALFGQCGFEEGILKNTYGTGCFILLNTGKDIKYSSKGLITTVAYGIGDDVHYALEGS
VFIAGAVIQWLRDNLGIIKNSSESEILAKMVEDNGGVYFVPAFVGLGAPYWDMFARGLII
GITRGVKREHIVRAALESIAYQTNDVIELMESETGIKIKELRVDGGASANNFLMQFQSDI
SNLKVVRPYITETTSLGAAFLAGLKVGIWKDLNEIKRIWREEKIFTPGMPEEKRRYYLAK
WKEAVTKARGWEKE
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtgtatattcttgccttagatcagggtactacaagttcaagggctataatatttgattct
ttggggaatataataggtgtggcccaaaaggaatttcctcagatttttccaaaacctggt
tgggtggaacacaatccatgggatatatggaattctcaaagggaagtaatgtttgaagct
atagaaaaagcaaagataaagcccaaagaaatttctgctattggagttacaaatcagaga
gagactactattgtgtgggataaagatacgggacaaccaatacataatgctattgtttgg
caatgtagaagaactgcagattattgtgagagattaaaaaaagatggactctcagagctt
gttaaagaaaagactggtctggttatagacgcatatttttctagtcctaagataaagtgg
attcttgataatgttcctgaggcaagaaaaaaggcagaacaaggaaagctactttttggt
actgttgatacctggcttatatggaatttaacggggagaaaagttcatgctacagattac
actaatgcctcaaggactatgctgtttaacataaaaaatttagattgggatgatgaactt
cttgaaataatgaacattcctcgtaatatgttacctaaacctcttccttctagttatttt
tatggtgtttgcaatatatttgaggatgcagaaattcctataacaggtatagcaggtgat
caacaggctgcattatttggacagtgtggcttcgaagaaggcattttgaagaatacttat
ggtacaggatgttttatacttcttaatactggaaaagatatcaaatattcctcaaaaggt
ttaattactactgtagcttatggaattggtgatgatgtgcattatgctcttgaaggtagt
gtgttcatagcaggagctgtaattcagtggcttcgagataatcttggaattattaagaac
tcttccgaaagtgaaattttggcaaaaatggtagaagacaatggtggagtatattttgtt
cccgcatttgtaggtcttggtgcaccttattgggatatgtttgcgagaggtttgattatt
ggtatcacaagaggtgtaaagagagaacatattgtaagagcagctttagaatctatagct
taccagactaatgatgtgatagagcttatggaaagtgaaacaggtataaaaataaaggag
ctaagagtagatggaggggcttcggcaaacaattttcttatgcaattccagtcagatata
tctaatttaaaagttgtgagaccttatattaccgagactacctctcttggtgcagctttt
ctggcgggtcttaaagtaggcatatggaaagatctcaatgagattaagagaatttggaga
gaagaaaagatatttactcctggtatgcctgaagagaaaagaagatattatttagcaaag
tggaaagaagccgtaacaaaagcaagaggttgggagaaagaataa

DBGET integrated database retrieval system