KEGG   Dictyoglomus thermophilum: DICTH_0699Help
Entry
DICTH_0699        CDS       T00774                                 

Definition
(GenBank) transcriptional regulator, GntR family protein
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
704900..705931
Genome map
AA seq 343 aa AA seqDB search
MGISPLVKEKIKEELLKIIESSRKDDYVKISSERELAQIFAVSRTTIRSVIKELIEEGML
VQIQGKGTYITPKTEKFVYVLNSPDLKSDDPFYSKFFVELTNKLTKKGFNLNFISMDRIA
RKKDKEVPVLIIGVINDGTIEKLKNNFRYLISIEQYFNHDEIIQISVDDYRIGWSAAEAL
IKRNHDYIIHLCGPERYTAPRLRKLGFWDRVKIEPKVKYEIIEGKMNYKSGYELGEKVLE
IFNKEKRSKIGIFAANDWMAIGLMQRLKEAGVIAGRDLSVIGCDDVPLSTEVVPNLTTFK
WDIEKIVEEILGVLSDIINKRKSVFDKRVLVPAEFVIRQTLMD
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgggtatatcgcctttagttaaagagaaaattaaagaggagttgctgaaaataattgaa
agtagtagaaaagatgactatgtaaaaatctcttctgagagagaactggctcaaatcttt
gctgtgagtaggaccactataagaagtgtgataaaggaactaatagaagaaggaatgtta
gtacaaattcaagggaaaggaacttatataacccctaaaacagaaaaatttgtttatgtt
ttgaattctccagatttaaaaagcgatgatcctttttactctaaattttttgtggaatta
acgaataaacttacaaaaaaaggttttaatttgaattttatatccatggatagaattgct
cgaaaaaaagacaaggaagtgccagtactcattataggggtaattaatgacggaactatt
gaaaaacttaaaaataatttcagatatttaatttctattgagcagtattttaatcatgat
gaaatcattcagatttctgtagatgattatagaataggttggtctgcggcagaggccctc
attaagagaaatcacgattatattattcatctttgtggaccagagagatatacggcacct
cgtttaagaaagttgggcttttgggatagagttaaaattgagcctaaggtaaaatatgaa
ataattgagggaaagatgaattataaatcgggttatgaattaggtgaaaaggtcttagag
atttttaataaagagaaaagaagtaaaattggaatttttgctgcaaatgactggatggct
ataggcttgatgcagaggttgaaagaggctggtgttatagcaggtagggacttaagcgtt
attggatgtgatgatgttcctttatcgacggaggttgttcctaatttgactacttttaaa
tgggatattgagaaaattgtggaagaaattttgggggttttgagtgatataataaacaaa
agaaagtctgtttttgataaaagagttcttgtgcctgctgaatttgtaataagacagact
ctaatggattga

DBGET integrated database retrieval system