KEGG   Dictyoglomus thermophilum: DICTH_0704Help
Entry
DICTH_0704        CDS       T00774                                 

Definition
(GenBank) bacterial extracellular solute-binding protein, family 5
  KO
K02035  peptide/nickel transport system substrate-binding protein
Organism
dth  Dictyoglomus thermophilum
Pathway
dth02024  Quorum sensing
Module
dth_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:dth00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    DICTH_0704
Transporters [BR:dth02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    DICTH_0704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: ACI19505
UniProt: B5YDG7
Position
713242..714816
Genome map
AA seq 524 aa AA seqDB search
MKKYIVFLLVLLLFVSFANSQTPKRGGTLVFGRGGDSVKLDPINVTDGESLRVTHQIFDT
LVKYKPNNTEVVPSLAVKWTVSKDQKVWTFYLRKGVKFHDGTPFNAQAVKFNFDRWRDPK
NPYHFGGEFEYWGYMFGGFPGIVKSVDVIDDYTVKITLTKPLAPFLSNLAMPCFAIASPT
AIKKYKEDFFKNPVGTGPFKFVSWIKGDKIVLEANKNYWDGAPYLDKIIFRSIPDNSARF
MELEAGTVDIIDGINPEDVERVKQNKNLQLFIRPSLNVCYIAMNMDKKPFDDIRVRLAIN
YAIDKKAIVDAYYPKGFAMVAKNPIPPSLWGYNDKIQDYSYDPEKAKKLLAEAGYPNGFK
TTLWAMPVNRPYIPQPMKVAEAVQSYLKAVGIDAEIVTYDWGTYLQKTENGEHDMAFLGW
TGDNGDPDNFFYVLLDKDNAVKGSAGNIAFYRSDELHEILIKAQTISNQKERAKLYEKAC
EIVHRDVPWVILAHTMPPLAGKKTVHNYIPHATGSEPLNKVWKE
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagtatatagtttttttattggttttattgcttttcgtaagttttgctaactct
caaacccccaaaagaggtggtacactagtttttggaagagggggagattcggttaagttg
gatccaataaatgttactgatggtgaatctttaagagttactcatcaaatttttgatact
ttagtgaagtataagcctaataataccgaagtagtaccctctttagctgtaaaatggaca
gtatcaaaagatcaaaaggtttggaccttttatcttagaaagggagtaaaatttcatgat
ggtactccctttaatgctcaggcagtaaaatttaattttgatagatggagagatcctaag
aatccttatcattttgggggagaatttgaatactggggatatatgtttggtggatttcca
gggattgttaaatctgtagatgtaatagatgattatacggtaaaaattactttaacaaaa
cctttagcaccgtttctttctaaccttgcaatgccatgctttgccatagcgagtcctaca
gctattaagaaatataaggaagatttctttaaaaatcccgtaggaacaggaccttttaag
tttgtttcctggattaaaggagataaaattgtcctcgaggcgaataaaaactattgggat
ggtgctccttacttagataagataatatttagatctattccagataattcagcaagattt
atggaacttgaggcagggactgtagatattattgatggtattaatccagaggacgtggag
agggtaaaacaaaataaaaacttacaactctttataaggccaagtttaaatgtatgctat
attgcaatgaacatggataagaagccctttgatgatataagggttaggttagctataaat
tatgctatagataaaaaagcaattgtagatgcttattatcctaaaggatttgccatggta
gcaaagaaccctattcctcctagcttatggggatataatgataagatccaagattactca
tatgatcctgagaaggctaagaagttgttagcagaggcaggatatcctaatggtttcaag
actaccttatgggcaatgcctgttaataggccatacatccctcaaccaatgaaggtagca
gaagcagtacagagttatttaaaagccgtaggtattgatgctgaaatcgttacttatgat
tggggaacatatcttcaaaagaccgagaatggtgaacacgatatggctttcttaggttgg
acaggagataatggtgatcctgataatttcttctatgtccttttagataaagacaatgcg
gtaaaaggaagtgcgggtaatattgctttttatagatctgacgaattacatgaaatactt
attaaagctcaaactatatctaaccaaaaagaaagagctaaattatacgaaaaggcttgt
gagatagtccatcgtgatgttccatgggtaatattggctcatacaatgccacctcttgct
ggaaaaaagacagttcataattatattcctcatgcaacaggaagtgagccgcttaacaaa
gtttggaaagaataa

DBGET integrated database retrieval system