KEGG   Dictyoglomus thermophilum: DICTH_0705Help
Entry
DICTH_0705        CDS       T00774                                 

Definition
(GenBank) hypothetical protein
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(714832..715263)
Genome map
AA seq 143 aa AA seqDB search
MSTIDPGFRDAKIPKNIPKKLAINIENKVNSIVAGNLIIISLITFSLVTIDLPRSPFISC
FKKIKYCIKIGLFKPSSSLIRASSPGVALSPKITLAGSPGINLINIKEIKETPIKIGIKS
NSLFIIYSFISLYHPNCKKEGGR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaacaatagatccaggctttagagatgctaaaattccgaaaaatatccccaaaaag
cttgctataaacatagaaaacaaggtcaactcaatagtagctggaaatctaatcataatt
tcattgataactttttctctagtcacaatagatcttccaaggtctccttttataagctgt
ttcaaaaaaatcaagtattgtattaaaattggcttattcaaaccaagctcttctctaata
cgtgctagctcgccaggagttgctctttctcctaagatcaccctagcaggatctccaggt
atcaatcttattaatataaaagaaataaaggaaactccaattaaaatagggattaaaagc
aatagtctttttattatatattccttcattagtttatatcaccccaattgtaaaaaagag
gggggaagataa

DBGET integrated database retrieval system