KEGG   Dictyoglomus thermophilum: DICTH_0706Help
Entry
DICTH_0706        CDS       T00774                                 

Definition
(GenBank) oligopeptide/dipeptide ABC transporter, permease protein
  KO
K02033  
peptide/nickel transport system permease protein
Organism
dth  Dictyoglomus thermophilum
Pathway
Quorum sensing
Module
Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:dth00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    DICTH_0706
Transporters [BR:dth02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    DICTH_0706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
715043..715876
Genome map
AA seq 277 aa AA seqDB search
MNKPILIQYLIFLKQLIKGDLGRSIVTREKVINEIMIRFPATIELTLFSMFIASFLGIFF
GILASLKPGSIVDTFVMFLALVGVSMPIFWLGLMLIWFGALYLGWFPPSGRLDVDINLNV
ITNFYLIDSVLTGNFKAFFNSLYHLILPSIALSSVPMATIARMTRSSMLEVLNQEYILVE
YAKGLPKRRIILRSALRNALIPIITVIGLEFGFLLGGAIMTETIFSWPGMGRLVYDAIMS
RDYPLIQGAILLSALLFVIINLIVDIIYVFIDPRIRY
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
ttgaataagccaattttaatacaatacttgatttttttgaaacagcttataaaaggagac
cttggaagatctattgtgactagagaaaaagttatcaatgaaattatgattagatttcca
gctactattgagttgaccttgttttctatgtttatagcaagctttttggggatatttttc
ggaattttagcatctctaaagcctggatctattgttgacacttttgttatgtttcttgct
cttgtaggagtgtctatgcctattttttggttaggtcttatgttaatatggtttggggct
ctctatttagggtggttccctccttcaggaagattagatgtagatataaacttgaatgtt
ataacaaacttttacttgattgacagcgttttaacaggtaattttaaagccttcttcaac
tctttgtatcatcttatcttaccgagtattgccttatcctcggtacctatggcaacaatt
gcaagaatgacaaggtcaagtatgttagaggtgctaaatcaagagtacattttagtagaa
tatgctaagggtttaccaaaaagaagaatcattttacgatctgctctaagaaatgcatta
atccccattattactgtgattgggctagaatttgggtttttgttgggaggggctattatg
acggagactatattctcatggcctggaatgggaagactagtatatgatgctataatgtct
cgagattatccgttaatacaaggagccatattgctatcagccttattatttgtaataatt
aatcttatagtggatataatatatgtttttatcgatccaagaatacgctattag

DBGET integrated database retrieval system