KEGG   Dictyoglomus thermophilum: DICTH_0708Help
Entry
DICTH_0708        CDS       T00774                                 

Gene name
mgsA
Definition
(GenBank) methylglyoxal synthase
  KO
K01734  
methylglyoxal synthase [EC:4.2.3.3]
Organism
dth  Dictyoglomus thermophilum
Pathway
Propanoate metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    DICTH_0708 (mgsA)
Enzymes [BR:dth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.3  methylglyoxal synthase
     DICTH_0708 (mgsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
716767..717228
Genome map
AA seq 153 aa AA seqDB search
MGYKEIVMGKQKRIALVAHDNKKQELLEWARFNRGTLSNHILYATGTTGDILEKELGLKI
IKFYSGPLGGDQQIGAKIAEGEIDFLIFFWDPLEPLPHDPDVKALLRIAVVWNIPIASNR
ATADFIISSPLMNMEYVRLVPDYEAYVHRKLNL
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgggttataaagagattgttatggggaaacaaaagagaattgccttagtggctcatgat
aacaaaaaacaggaattattagaatgggcaaggtttaacagaggaacattgtctaaccat
attctgtatgctactggaactactggtgatattttagaaaaagaacttggtttaaaaata
ataaaattttatagtggtccacttggaggagaccaacagattggagcaaaaattgcagaa
ggggagatagattttctcatatttttctgggatccattagaaccactccctcatgatcct
gatgtaaaggcacttcttagaattgctgtggtatggaatattcctatagcttcgaataga
gctacagctgattttataatctcctctccactaatgaatatggagtatgtaaggcttgtt
cctgactatgaggcttatgttcacagaaaattgaatttgtaa

DBGET integrated database retrieval system