KEGG   Dictyoglomus thermophilum: DICTH_0709Help
Entry
DICTH_0709        CDS       T00774                                 

Definition
(GenBank) outer membrane protein, putative
  KO
K19765  
heat shock factor-binding protein 1
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
717446..719293
Genome map
AA seq 615 aa AA seqDB search
MSRRILSLVLMVFLVLSVSYAQVGKFKDVPSNHWAAEAVKYLTDLGIISGIKPDTFAGDL
YVTRYQVAVLLYKLIQALQTGKIALPATDVSELKDLVSQLQDELQLIGANVEDLMNALQD
LDSRVSDLETAITEKVGVEDVENIVNEALADVNARLDDLEAKIEAIEKVEITPEQIEAVV
GDKLEQLVESKMEELTSRVTDLEGFVTDLDSRLADVEAALVDKPSLDEVEAMIEEKLGSI
EVPDVEELTGRVTDLEDRVSAVETRLDDVDSAISDIMSSVDDLNANLVDLSGKVDEVLAL
KDQLDELIARIESIQGIEIPVELDEIKSFIMDLDSRLTELSTSVDDLSTVVADLQSQIDD
INSKFDQVNTNIDNINSSIEALSTSVDDLFVLNDGVSTRLDETVNRLVTLEERVATLENK
ATVEKNFALDLRFTVKVGLATRTPVNTLTTKLTFNLMPSVKLFLQSVSSASGIDMSGGVD
ASMPISKDITGVAGASYDNGKFSVYGGVKLAMLKNAVIDVIVGVPDVMALGSGELKDTVS
LKIGGSYKLTDKVSLTGYATNLEGGAAAANFAVVYAVDPKADLSLGLYLYGLGNLLGGNF
DAVQKSVVFSAGASF
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgagtaggaggattttaagtttagtattaatggtattcttagtcttaagtgtttcttat
gcacaggtaggtaaatttaaggatgttccatctaatcattgggcagcagaagcagttaag
tacttaacagatttagggataatttctggaatcaaacctgatacttttgctggagatcta
tatgtaacaagatatcaagttgctgtcttactctataagttaatacaagctctacaaact
ggtaaaatagccttgcctgcaaccgatgttagtgaacttaaagaccttgtttctcaactc
caggatgaattgcagcttattggagcaaacgtagaagatttaatgaatgcgttacaagat
cttgattcaagagtttctgacttagaaacagcgattactgagaaagtgggagtagaagat
gtagagaatatagtcaatgaggcacttgcggatgtaaatgcaaggcttgatgatttagag
gcaaagatagaagctatagaaaaagtggaaattactcctgaacaaattgaggcagtagtt
ggagataagttagagcaacttgtagaatcaaaaatggaggagttaactagcagagttact
gatcttgagggatttgttactgacttagattcaagacttgcagatgttgaggcagcatta
gtagataagccatctttagatgaagtagaggcaatgattgaggagaaattaggttcaatt
gaggttccagatgtggaggagttaactggcagagttactgatcttgaggatagggtttcg
gcagttgaaacaagacttgatgatgtagacagtgcaatttctgatattatgagttcagta
gatgatctaaatgcaaatcttgtagatctttctggaaaggtcgatgaggtacttgcatta
aaagatcaacttgatgagttaatagcaaggatagaatctatacagggtatagagattcct
gtagaacttgatgagattaaatcattcataatggatttagactcaaggttaacagagctt
tctaccagtgtagatgatctaagtacagtagtagctgatttacaatctcagattgatgat
attaattcgaaatttgatcaagttaatacaaatattgataatatcaactcttctatagaa
gctctatctaccagtgtggacgatctatttgtgcttaatgatggagtatctacaagatta
gatgaaacagtaaatagattagttactttagaagagagggtggctactcttgagaataaa
gctactgtagagaagaattttgcattggatttaagatttacagtaaaagttggtttggcc
acaagaaccccagtgaatactcttacaacaaagttaacatttaatttgatgcctagtgta
aaactcttcttacaatctgtgagtagtgctagtggaattgatatgtctggtggtgtagat
gcaagcatgccaattagcaaagatataacaggtgttgcaggagcttcatatgataatggt
aagttctcagtttatggtggtgtgaagcttgcgatgttaaagaatgctgtaattgatgtt
atagtaggagttccagatgttatggctcttggcagtggagaactaaaagatacagtatct
ttgaagattggtggatcttataaattaactgataaagttagcttaacaggatatgcaaca
aatcttgaaggtggtgcagcagcagctaattttgcagtagtgtatgctgtagatcctaag
gctgatctatctttaggattgtacttgtacggtctaggaaatctacttggaggtaatttt
gacgctgtccaaaaatccgtagtattctctgcaggagcttccttctaa

DBGET integrated database retrieval system