KEGG   Dictyoglomus thermophilum: DICTH_0723Help
Entry
DICTH_0723        CDS       T00774                                 

Definition
(GenBank) FimO
  KO
K02653  
type IV pilus assembly protein PilC
Organism
dth  Dictyoglomus thermophilum
Brite
Secretion system [BR:dth02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   DICTH_0723
Bacterial motility proteins [BR:dth02035]
 Pilus system
  Pilus assembly proteins
   DICTH_0723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
732524..733753
Genome map
AA seq 409 aa AA seqDB search
MAKVYVYQARNMKGELVTGEYEAENMREVAIRLRGMNLYPIRIEEKRTPSSFFSLTLAPK
KERVGKVKLTDLTVFTRQFATMINAGLSLSTCLNILSEQSESKALKQILKEVQRMVDEGS
SLSEAFAKFPDVFSPLYINMVKAAESAGTLDETLERLAVTLEKQQELRRKIKSAMTYPVI
VLIIAIGAGFGMLTFLVPIFAGMFESMGAQLPLPTAILLKMSKFITSNILLILLGAIILV
LGAIRAWKNPKIKDKIDEIILKIPVFGGLIQKTSVVNFATTLAAQVRTGVPILQALQLAG
QTAGNSVFRKAIDLTRQRVREGERIAPVLRETKVFPPMVVHMISIGEESGSLEQMLNKIA
EFYEGEVAAAVESLTSLIEPLMMVFVGGIVGGMLIALYLPIFTMFQYIK
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagtatatgtttatcaagcacgaaatatgaaaggtgagttagtcactggagaa
tatgaagcagaaaacatgagagaggtagccataaggttaagaggaatgaatttgtaccct
ataagaatagaggagaaaagaacgccctcctcatttttcagtttaacattagcgcctaaa
aaggaaagagttggaaaggtaaagttaacggatcttacagtgtttacaagacagtttgct
acaatgattaatgcaggcctttctctttctacttgtctaaatattctctctgaacagagt
gaaagtaaagcattaaagcagatactaaaggaagttcagagaatggtagatgaaggaagt
tctctttctgaggcttttgcaaaatttcctgatgttttttctcctttatatataaatatg
gtgaaagcagcagaatctgctggaaccctcgatgaaactttggaaagacttgcagtgact
cttgaaaagcaacaggaattaagaagaaaaataaaatctgccatgacttacccagttata
gtgttgatcattgctattggagctggttttggcatgttgacctttcttgttcctatattt
gcaggtatgtttgaaagtatgggagctcaacttcctttacctactgccatactcttaaag
atgagtaaatttataactagcaatattcttttgattttgcttggggcaataattttagtg
ctgggagccataagagcttggaagaatcctaagataaaggataaaatagacgaaataatt
ttgaagattccagtttttggaggcttaattcaaaagacctcagtggtaaattttgcgacc
actcttgcagctcaggtaagaactggagttcctatccttcaagcattacagctcgccgga
caaacagcaggaaatagtgtgtttagaaaagcaattgatttaacaaggcaaagggttaga
gagggagaaagaattgcgcctgttttaagggaaacaaaggtattcccaccaatggtggta
catatgatatctattggagaagaatctggttctttggaacaaatgttaaataagatcgca
gaattttatgaaggtgaagtagcagcagcggttgagagtttgacttctcttattgagcct
ttaatgatggtatttgtgggtggtatagttggtggaatgctaattgcattatacctacct
atattcaccatgttccagtacataaaatga

DBGET integrated database retrieval system