KEGG   Dictyoglomus thermophilum: DICTH_0724Help
Entry
DICTH_0724        CDS       T00774                                 

Definition
(GenBank) SigF
  KO
K03090  
RNA polymerase sigma-B factor
Organism
dth  Dictyoglomus thermophilum
Brite
Transcription machinery [BR:dth03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     DICTH_0724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
733750..734457
Genome map
AA seq 235 aa AA seqDB search
MIKPALELWLKYRETGDKKVLEELLEVFDDLIYYWASKFTSYGEPLEDLVQIGYLGFLKA
VENYDPEKGDLSTYISHYVLGEIRHHLRDKIDKIKIPRSVKGLINKMDNFIKEVWEKENR
SPSCEEIAKHLNITVESVEELFKIKEAMMTVSLEDLEIEMDRIRAEKLESFKLPIEDKIA
LEQALAKLPDIQRKVIEYIFYQDLTQTEVAKILKISQSQVSRILRSALEKLKEML
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacccgctttagagctttggctaaagtatagagaaacaggggataaaaaagtt
cttgaggaactccttgaagtttttgatgatctgatatactactgggcttcaaagtttact
tcttatggagagcctttagaagacttagtacaaataggttatcttggctttttaaaggct
gttgaaaactatgatcctgaaaagggtgatctttccacatacatttctcattacgtatta
ggtgaaataaggcatcatttaagggataaaatagataaaataaaaattccaagaagtgtt
aagggtttgataaataagatggataattttataaaagaggtgtgggaaaaggaaaataga
tctccttcttgtgaggaaattgcgaagcatctaaatattactgtagaatcggtagaagag
ctttttaaaattaaagaggctatgatgactgtatctctggaagatttagagattgagatg
gatagaataagagctgagaaattagaatcttttaaacttccaatagaagataagattgcc
ttagaacaagcattagctaaacttcctgatatacaaagaaaggtaattgagtatattttt
tatcaggacttaactcaaacagaggtagcaaaaatattaaagatatcccagtcacaggtt
tcgagaatattaaggagtgctttggagaagttgaaagaaatgctttaa

DBGET integrated database retrieval system