KEGG   Dictyoglomus thermophilum: DICTH_0725Help
Entry
DICTH_0725        CDS       T00774                                 

Definition
(GenBank) prokaryotic N-terminal methylation motif domain protein
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
734551..735006
Genome map
AA seq 151 aa AA seqDB search
MRRERGFTLIELMVVIVIIAILAAVALPNFMGATERARESAVRSAMKTIQTALEMYATEH
SGTYTNDLNGILPHLPGNKFPNSPATNSPYVIGQNLMQASGNPPSTPVLNTNPNTNEQYA
IVYLYNPVENSYTLKGYNRTNTKEVLTLSNK
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgagaagagagagaggttttacactaattgagttgatggtagttattgtgatcattgca
attttagcagcagtagcacttccaaactttatgggagcaactgagagagcaagagagtct
gcagtaagaagtgctatgaagactatccaaacagcattagagatgtatgcaacagaacat
agtggaacatatacgaatgatttaaatggtatattgcctcatttacccggcaataaattc
cctaatagtcctgcaacgaattctccttatgttattggtcaaaaccttatgcaagctagc
ggtaatcctccatctacaccagtcttgaatactaaccctaacactaatgagcaatatgct
atagtttacttatataatcctgtagagaattcctatactttaaaggggtataataggact
aacactaaagaagttttgactctttcaaacaagtag

DBGET integrated database retrieval system