KEGG   Dictyoglomus thermophilum: DICTH_0727Help
Entry
DICTH_0727        CDS       T00774                                 

Definition
(GenBank) Smc1 chromosome segregation protein, putative
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
735541..735963
Genome map
AA seq 140 aa AA seqDB search
MAEDRWKKLWDTLKPQIASAIQKAGETAQKAGEVISEMAKTLGKESAKLAKIGKLKADIL
ILEGNKDNLLRKLGEKLYQLYKNEEEIKKEVFSELVKEIEELDKKILEKQKEIESIAKEE
NLNPEDIEKIPAVEDEEKKD
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggacagatggaagaaactatgggatactctaaagcctcagatagcttcggca
attcaaaaggcgggagagactgctcaaaaagctggtgaagtaatttcagagatggcaaag
actcttggtaaagagtctgctaaactcgctaaaattggaaaattaaaggcagatattctt
attcttgaaggaaataaagataaccttttaagaaagcttggagaaaagttataccaatta
tataagaatgaggaagagattaagaaagaagtattttctgagcttgtgaaagaaatcgag
gaattagataagaagattttagagaaacagaaagagatagaaagcatagcaaaagaggag
aatttgaatccagaagatatcgaaaaaattcctgctgttgaagatgaagaaaagaaagat
taa

DBGET integrated database retrieval system