KEGG   Dictyoglomus thermophilum: DICTH_0731Help
Entry
DICTH_0731        CDS       T00774                                 

Gene name
uvrB
Definition
(GenBank) excinuclease ABC, B subunit
  KO
K03702  
excinuclease ABC subunit B
Organism
dth  Dictyoglomus thermophilum
Pathway
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:dth00001]
 Genetic Information Processing
  Replication and repair
   03420 Nucleotide excision repair
    DICTH_0731 (uvrB)
DNA repair and recombination proteins [BR:dth03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     DICTH_0731 (uvrB)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      DICTH_0731 (uvrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
739816..741804
Genome map
AA seq 662 aa AA seqDB search
MSGFILVSEFKPCGDQPQAIEKLTEGVKRGLRYQTLIGVTGSGKTFTMANIIANVQKPTL
VIAPNKTLAAQLYSEFKEFFPYNAVEYFVSYYDYYQPEAYIPQTDTYIEKDADINDRIDR
LRHSTTSSLLSRRDVIVVASVSCIYGLGSPTDYAEMILMVKRGEDLPRDTLLRKLIKLQY
ERNDYEFTRGKFRVRGDVVEVFPIGGETAIRIEYWGDTIERISEIDPLNGKRVVDFNEVF
IYPATHYIAPTEKMERAIESIKRELEERLEELRSQGKFLEAKRLEARTLYDIELLREVGY
CKGIENYSRHFDGRKPGEPPYTLLDYFPDDFLVFIDESHLTIPQLRAMYHGDKSRKDNLV
EYGFRLPSAYDNRPLTFEEFWERVPQVIFVSATPAEFELSVSEQVVEQLIRPTGLLDPEI
EVHPTEGQIDHLISEIKKVVARGERVLVTTLTKRTAEDLVEYLSNLGINVTYLHSEIETL
ERTGILQSLRLGKFDVLVGINLLREGLDLPEVSLVAILDADREGFLRSERSLIQVMGRAA
RNVNGKVIMYADVITDSMRRAIEETQRRRRIQMEYNQAHGITPKSIKKPVKEVFDFVEAV
SEKKVDYKAVSKKLSIDEIEEVIKQLEKEMYEAAAELDFEKAAYLRDQIKELKNELKKKT
RL
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgagtggatttatattagtttctgaattcaaaccctgtggtgatcagcctcaggctata
gagaaacttaccgaaggagttaagaggggtcttagatatcagacccttataggggttact
ggttctggaaaaacttttaccatggcaaatattatagcaaatgtacagaagcctaccctg
gttattgctcctaataaaactttagcagcccagctttatagtgagtttaaagagtttttt
ccctacaatgctgtggaatattttgtaagctattacgattattaccaacccgaagcttac
attccccaaacggatacttatatagaaaaggatgcagatattaatgacagaatagatagg
ttgagacatagtactacaagttctctcttgtctcggagagatgtaatagtagtggcaagc
gtttcatgtatatatggcttaggttctcctaccgattatgcagaaatgatccttatggta
aagagaggagaagatcttccaagagatactttacttagaaaacttattaaacttcagtat
gaaaggaacgattatgaatttactagaggaaagtttagggtaagaggagacgtagtagaa
gtttttcccataggcggagagaccgctataaggattgagtattggggagataccattgag
aggatttcagagattgatcctctgaatggaaaaagagttgttgattttaatgaggttttt
atatatcctgcgactcactatatagctcctacagaaaagatggaaagagctattgagtct
ataaaaagagagcttgaggaaaggcttgaagagttgagatctcaaggtaaatttcttgaa
gcaaaaagacttgaagcaagaactctttatgatatagaacttttgagagaagtaggatat
tgtaaaggaattgaaaactattcaagacattttgatggaagaaaaccaggagagcctcct
tatacccttcttgattattttcctgatgattttcttgtatttatcgatgagtcccattta
accattcctcaacttagagccatgtatcatggtgataagtcgagaaaggacaatttggta
gagtatggttttagattaccctctgcctatgataatagacccttaacctttgaggaattt
tgggaaagagttcctcaagtaatttttgtttctgctactcccgcagagtttgagttgtca
gtgtcagaacaggttgtagaacagcttataagacctacaggacttcttgatcctgaaata
gaagtgcatcctacagaaggacagatagaccatttaatatctgagataaaaaaggtagta
gctcgtggagaacgagtacttgttactacacttaccaaaagaacagcagaagatcttgtt
gagtatctttcaaatcttggtatcaatgttacttatctccattccgagatagaaactttg
gaaagaacagggattttgcagagtttaagacttggaaagtttgatgtccttgtaggaata
aacttgcttagagaagggcttgatcttcctgaagtatctttggtggcaatccttgatgca
gatagggaaggatttttgagatcagaaagatctcttattcaggtaatgggaagggctgca
agaaacgtaaatggtaaagtaataatgtatgcggatgtgataacggactctatgaggaga
gctattgaagagacacaaagaagaagaagaattcaaatggaatataaccaggctcatggt
ataactccaaagagtatcaaaaaaccagtaaaagaggtatttgattttgttgaagcagta
tcagagaaaaaagttgattataaagcagtctctaaaaagttatctatagatgagattgaa
gaggtaataaaacaacttgaaaaggaaatgtatgaagcagctgcagagcttgattttgaa
aaggctgcctatttgagggatcagattaaagaattaaaaaatgaattgaaaaagaagaca
agattatga

DBGET integrated database retrieval system