KEGG   Dictyoglomus thermophilum: DICTH_0733Help
Entry
DICTH_0733        CDS       T00774                                 

Definition
(GenBank) methylated-DNA--protein-cysteine methyltransferase
  KO
K00567  methylated-DNA-[protein]-cysteine S-methyltransferase [EC:2.1.1.63]
Organism
dth  Dictyoglomus thermophilum
Brite
Enzymes [BR:dth01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.63  methylated-DNA---[protein]-cysteine S-methyltransferase
     DICTH_0733
DNA repair and recombination proteins [BR:dth03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   Direct repair
    DICTH_0733
 Prokaryotic Type
    DICTH_0733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_binding_1
Motif
Other DBs
NCBI-ProteinID: ACI19518
UniProt: B5YDJ4
Position
744628..745110
Genome map
AA seq 160 aa AA seqDB search
MKGALKLDKGFIVVEYESSLIKRVYWTNESEEEKNFPGRELFIDYFSGKKVDFGELNIDL
TEFPSFFKRIYEVARRIPYGKVTSYKSIAELIGNSKLQRVVGNAMKNNPFLIIVPCHRVV
KSDGSLGNFSLGVEFKKYLLTLEGVRLENEKVSCFRYWWY
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaggtgctcttaagttagataaagggtttatagtagtggaatatgaaagtagtctg
attaagagagtatattggacaaatgaatctgaagaagagaagaattttccaggaagagaa
ctttttattgattacttttcaggtaaaaaagttgattttggtgagttaaatattgatttg
actgagtttccttctttttttaagagaatttatgaggttgcaagaagaataccctatgga
aaggttacaagttataagagtattgcagaacttattggaaatagtaagcttcagagggtt
gtaggaaatgctatgaaaaacaatcctttcttgattatagtcccatgtcatcgagttgta
aaaagtgatggaagtttaggaaatttttctcttggagtcgaatttaaaaaatacttattg
accttagagggggtaaggttggagaatgaaaaggtatcttgctttagatattggtggtac
taa

DBGET integrated database retrieval system