KEGG   Dictyoglomus thermophilum: DICTH_0734Help
Entry
DICTH_0734        CDS       T00774                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
dth  Dictyoglomus thermophilum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DICTH_0734
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DICTH_0734
   00052 Galactose metabolism
    DICTH_0734
   00500 Starch and sucrose metabolism
    DICTH_0734
   00520 Amino sugar and nucleotide sugar metabolism
    DICTH_0734
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DICTH_0734
   00524 Butirosin and neomycin biosynthesis
    DICTH_0734
Enzymes [BR:dth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     DICTH_0734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
745073..746026
Genome map
AA seq 317 aa AA seqDB search
MKRYLALDIGGTKIACGRFTEDGLLEEKILFPTRAERGYKEILKDIVSVLLRLKTEDTIA
LGVGTAGPLDRIKGEIYSPPNLPGWDGVPLKKDLYENLKIPIFIDNDANAACLGEYIFGA
GKGVKNMVYVTVSTGIGGGIIINGSLVHGVRDSAGEVGHQTIVPDGPLCNCGNKGCLEAL
SSGTAIAKRAMEEINSGKDTILKQWAKNEKITAKHVREAMLMGDEVAREIWNNAMEYLGI
GIGNIITIVSPERVVIGGSIGLSGKDVIEKIREVVKRRVFLVPVDMVDIVQAELGEDVGI
YGAFAVALVEMRNRGGD
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggtatcttgctttagatattggtggtactaagattgcctgcggaaggtttact
gaagacggtcttttagaagaaaagattttattccccacaagagcagaaagaggttataaa
gagattttaaaagatatagtttctgtacttttaaggttgaagactgaggatactatagct
cttggagttggtactgcaggtccccttgatagaattaaaggagagatatattctccgcct
aatctcccaggttgggatggtgttcctctaaagaaagatctttatgaaaatttgaaaatt
cctattttcattgacaatgatgctaatgctgcttgtttaggagaatatatttttggtgct
ggaaaaggagtaaaaaatatggtttatgttacagtaagcactggtataggtggaggaatt
attataaatggtagtttagtacatggagtaagggatagtgctggagaagtggggcatcaa
accatagttcctgatggtcctttatgtaattgtggaaataaaggatgtttagaagctctc
tcttcgggcactgctatagctaaaagagcaatggaagaaattaatagtggaaaggatact
atattaaagcaatgggcgaaaaatgaaaaaataactgcgaagcatgttagggaagctatg
cttatgggggacgaagttgcgagagagatttggaataacgctatggaatatttgggtata
ggcataggaaatattattaccattgtttcgcctgaaagagtggttataggtggaagtatt
gggctttcaggtaaagatgtaattgaaaaaataagagaagtggttaagcggagggttttt
cttgtgcctgtagatatggtagatatagttcaagcagaattaggcgaagatgtaggtata
tatggtgcttttgcggtagctttagtagaaatgagaaatagaggaggggattaa

DBGET integrated database retrieval system