KEGG   Dictyoglomus thermophilum: DICTH_0739Help
Entry
DICTH_0739        CDS       T00774                                 

Definition
(GenBank) cation transport ATPase
  KO
K01537  
Ca2+-transporting ATPase [EC:3.6.3.8]
Organism
dth  Dictyoglomus thermophilum
Brite
Enzymes [BR:dth01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.8  Ca2+-transporting ATPase
     DICTH_0739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
749830..752442
Genome map
AA seq 870 aa AA seqDB search
MWYKLTKEEVLKELRVDPEKGLAEQEVEERRKKYGENKIPEKKSKSFINIFFSQFKEFLT
IVLIIATLISFLLGEIKDAVAILIIVIINAILGSVQEYKAEKTLESLKSYVSPKANVLRD
GKIIKVDIEELVPGDIVLIEEGEKMPADLRLIETNNLQVDESILIGESVPVRKDADFVAQ
EDITLGDQINMAFKGTTVVSGRGKGVVVGTGLNTALGDIAKMLSEMEEEPTPLQKELEKL
GKQLTYVILSLVALLLFIGIIQEREFFDMFLTAVSLAVAAIPEGLPTVITILLAIGVQEM
AKRKAIVRKLSAVEALGATSVICTDKTGTLTENKMDLVKIVLPNGEMVEKKDYKKQKEKI
RDILETALLASSVRVTSDGSYIGDALDVAIYKNFEETYGNKPENLTKVDELPFDSSRKRV
SILYKVLSEDKYLLCVKGAGEEILQRSNTYQEENVIKPMSVEDRKRFMEIQDLLSKDGLR
VLAVAKREFDEIDERDEWEKDLIFLGFIAFMDPLREGVKEAIEKCKEAGIRPIIVTGDYL
LTAKKIAEDLGIDVDSGSTYTGLDLQRQDLDSLDWDSVVLFSRVLPEQKMNIVKELKERG
EIVAMTGDGVNDAPALKMADIGVGMGLRGTDVAREASDLVLLDDSFATIVRAVEEGRRIF
DNIRKVTYYLLTCNFSEILVVSLSVFLGYPLPLTPIELLWINLVTDGFPALALGVEPPEK
DIMSRKPRKLNEGIINKSMWKNIIIDGILIGIAAFVLFVIGSKENINTGRTMAFTGIVFS
QIFQALRLSLRKRKSLFRERFSNKYLTLAVLFSLFLQVLVVFTPIGIRFFNLERLSVREF
LLTLVLALFPIYLLTGEKIYEKIFKRNINL
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
ttgtggtataaacttacaaaagaagaagtgctgaaagaactaagggtagatcctgaaaag
ggtttggcagagcaagaagtcgaagaaagaaggaaaaaatatggagaaaacaaaatcccc
gagaaaaaatcaaaaagtttcataaatatattttttagtcaatttaaagaatttcttact
attgttcttataattgcaactctaatatcttttcttcttggagagataaaagatgctgtt
gcgatcttaattattgttataatcaatgctattcttgggagtgttcaagaatataaagct
gaaaaaacccttgaatctcttaaatcttatgtttctccaaaagcgaatgtattgagagat
ggaaaaattataaaagtagatattgaagaattggttcctggagatatagttttgattgag
gaaggagaaaaaatgccagctgatttaaggttgattgaaactaacaatctacaggtagat
gaatctatattgataggagaatcggttcctgtaagaaaggatgcagattttgttgctcaa
gaagatataactttaggagatcaaattaatatggcatttaaaggaaccacagtcgtaagt
ggtagaggcaaaggtgttgttgtggggactggtttaaacacagctcttggagatattgct
aaaatgctttcagagatggaggaagaacctactcctctgcaaaaagaacttgaaaaatta
ggaaaacagctcacttatgtaatattatccctggtggctcttcttctttttattggaatt
atacaagaaagagaattttttgatatgtttcttactgcagtaagtcttgctgttgcagca
atacctgagggtttacctacagtaataaccattcttcttgccattggagtccaagagatg
gctaagaggaaagcaatagtgagaaaactttcagcggtagaggctttaggagcaacctct
gtaatctgtactgataagacaggaactttgacggaaaataaaatggatttggtaaaaata
gtattgcctaacggggagatggtagaaaaaaaagactataagaaacaaaaggaaaagata
agagatatacttgagacagcgcttcttgctagtagtgtaagagtaactagtgatggtagt
tatataggagatgctttagatgtagcaatttataagaattttgaagagacttatggtaat
aaacctgagaatttaacaaaagtagatgagcttccttttgattcttctcgaaaaagagtg
agtattttatacaaggtcttatctgaagacaagtatttattgtgtgtaaaaggtgcggga
gaagagatattacaaagaagtaatacttaccaagaagagaatgtgataaaacctatgagt
gttgaagatagaaaaagatttatggagattcaggatcttctttctaaagatggattaagg
gttcttgcggttgctaaaagagagtttgatgagattgatgaaagagatgaatgggaaaag
gatttaatctttttaggttttatagcttttatggatcctttgagagaaggtgtaaaagag
gctattgagaaatgtaaagaggcaggcataagacccattattgttacaggagactattta
cttactgctaaaaagattgctgaagatttaggtatagatgtcgatagtggatctacctat
actggattagatttacagaggcaagatctagattctcttgattgggatagcgtggtactt
ttctctagagttcttccagagcaaaagatgaacatagtaaaagagttaaaagaaagagga
gaaatagtggctatgactggagatggagtaaatgatgctcctgctttgaaaatggcagat
ataggggtaggaatgggattgaggggaaccgatgtagcaagagaagcctctgatttggtg
cttttagatgatagttttgcaactatagtcagagcagtagaagaaggtaggaggattttt
gataatattagaaaggttacttattatctgttaacttgcaattttagcgaaattttagtg
gttagtttaagtgtatttttaggctatcctttacctttgactcctatagagcttctatgg
ataaatttggtgactgatggctttcctgctcttgctcttggagtcgagccccctgagaaa
gatatcatgagtcgaaagcctcgcaaattgaatgaagggattattaataagagtatgtgg
aaaaatattattatcgatggtattcttataggtatagcggcttttgtgctttttgtgata
ggaagtaaggagaacattaatactggaaggactatggcttttacaggtattgttttttct
caaatatttcaagcattaagactgtctttaagaaagagaaaaagtctttttagagagaga
ttttctaataagtatttaactcttgcggtattgttttctctgtttttgcaagttcttgta
gtgtttactcctatagggataagattttttaatttggaaaggttaagtgtaagagaattt
ttattgactttagtcttggctctgtttcctatctatctattaacgggagagaaaatttat
gaaaagatttttaagagaaatattaatttatag

DBGET integrated database retrieval system