KEGG   Dictyoglomus thermophilum: DICTH_0988Help
Entry
DICTH_0988        CDS       T00774                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
dth  Dictyoglomus thermophilum
Pathway
dth00010  Glycolysis / Gluconeogenesis
dth00052  Galactose metabolism
dth00500  Starch and sucrose metabolism
dth00520  Amino sugar and nucleotide sugar metabolism
dth00521  Streptomycin biosynthesis
dth01100  Metabolic pathways
dth01110  Biosynthesis of secondary metabolites
dth01120  Microbial metabolism in diverse environments
dth01130  Biosynthesis of antibiotics
dth01200  Carbon metabolism
Module
dth_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DICTH_0988
   00052 Galactose metabolism
    DICTH_0988
   00500 Starch and sucrose metabolism
    DICTH_0988
   00520 Amino sugar and nucleotide sugar metabolism
    DICTH_0988
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DICTH_0988
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    DICTH_0988
Enzymes [BR:dth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     DICTH_0988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Hydant_A_N Glucokinase DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: ACI19961
UniProt: B5YE80
Position
968663..969625
Genome map
AA seq 320 aa AA seqDB search
MRKAVGVDLGGTKINVLLVDDQGKVLGRDKQPTESEKGKDHVINKIKSMIDNVLNQAGLK
ITEIEGIGIGFPGLMDRDKKTTLYAPNLGDEWKKEVLLGKELEETFNVPVYLENDVNLIA
WAEWLVGAGRGTKTMICVALGTGIGSGIVLNGKLWIGAHGMAGEFGHTTVLPDGPVCGCG
NRGCIEAIASGTGIEKYAKSILPQYPNSLIWELCNGNLDEVTVKIIYQAAERGDKLAVDI
FNYAGYYLGIALANYVHIIDPEKIVIGGGVANVREYIGKPMKEEFYKRVLPSFRDKVTFS
WAELGEDAGGIGAALLVLYR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaggctgttggggttgatcttggaggaacaaaaataaatgtacttcttgttgat
gatcaaggaaaggttttgggaagagataagcaacctacggagtcagagaagggtaaggat
catgttataaacaaaattaagagtatgatcgataatgtactgaatcaggcaggattaaaa
ataacagagatcgaaggaataggaatagggtttccaggccttatggatagagataagaaa
actaccctatatgctcccaatttaggagatgagtggaaaaaagaagttcttttaggaaaa
gagctggaagagacttttaatgtacctgtctatttagaaaatgatgttaatttgattgct
tgggcagagtggttagtaggagcaggaagaggaacaaaaactatgatttgtgtagctctt
ggtacaggtataggttcgggtattgtgctaaatggtaaactttggattggagctcatgga
atggcaggtgaatttggtcatacaacagtgcttcccgatggtcctgtctgtgggtgtggt
aataggggatgtattgaggctatagcttctggaactggtatagaaaagtatgcaaagagt
atcttaccccaatatcctaacagtttaatatgggaactctgtaatggtaatttggatgag
gtaactgttaagattatctatcaggcagcagaaagaggagataagttggcagttgatatt
tttaactatgcagggtattatttaggcattgcccttgctaattatgttcatattatagat
cctgagaagattgtaattggtggtggagtagcaaacgtgagagaatatataggaaagcct
atgaaagaagagttttataaaagagttttaccaagttttagagataaggttactttttcg
tgggcagagcttggtgaagatgcgggaggaataggggctgcattattagtattatataga
tga

DBGET integrated database retrieval system