KEGG   Dictyoglomus thermophilum: DICTH_1005Help
Entry
DICTH_1005        CDS       T00774                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dth  Dictyoglomus thermophilum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DICTH_1005 (tpiA)
   01230 Biosynthesis of amino acids
    DICTH_1005 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DICTH_1005 (tpiA)
   00051 Fructose and mannose metabolism
    DICTH_1005 (tpiA)
   00562 Inositol phosphate metabolism
    DICTH_1005 (tpiA)
Enzymes [BR:dth01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DICTH_1005 (tpiA)
Exosome [BR:dth04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DICTH_1005 (tpiA)
  Exosomal proteins of bladder cancer cells
   DICTH_1005 (tpiA)
  Exosomal proteins of melanoma cells
   DICTH_1005 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
984982..985731
Genome map
AA seq 249 aa AA seqDB search
MRRKIIAANWKMYKTCAETESFIKEFIELSKGYEEKEIVICPPFTSLYVASKLLKDTAIK
LGAQNMFWEKEGAYTGEISPIMLKDLNCTYVIIGHSERRNYFSETNEMINKKIKSAFNYG
LIPIFCVGEKWEERERGKTEEVITKQVREGLEGLEKENVEKIVIAYEPVWAIGTGHSAKG
EDANEVAGLIRKIISEMYDTEVSQKIRIQYGGSVNPQNITEFLSQNEIDGALVGGASLKP
QSFWNIVKS
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
ttgaggaggaaaattattgctgcaaattggaaaatgtacaaaacttgtgcagagactgag
agttttataaaagaatttatagaactttcaaaaggatatgaggaaaaggaaattgtaata
tgcccaccatttacctctctatatgtagctagtaaacttcttaaagatacagctattaaa
ttaggggctcaaaatatgttttgggaaaaagaaggagcatatactggagaaatctctccc
ataatgcttaaagatttgaactgtacctatgttataataggacattctgaaaggagaaat
tatttttctgagactaatgagatgataaataagaaaataaaatctgcttttaattatggt
ttgatacctattttctgtgtgggagagaaatgggaagaaagagagagagggaaaacagaa
gaagttattactaaacaagtaagggaaggtttggaaggtttagaaaaagaaaacgtggaa
aaaattgttatagcttatgagccagtatgggctataggaacaggccattctgcaaagggc
gaagacgctaatgaggttgcaggtttaataagaaagataatatctgaaatgtatgataca
gaagtttctcaaaaaattagaattcagtacggtggtagtgttaatccccaaaatattacc
gaattcctatctcaaaatgagattgatggtgctttggtgggtggagcaagcttaaagcca
cagtctttttggaacatagtaaaaagttag

DBGET integrated database retrieval system