KEGG   Dictyoglomus thermophilum: DICTH_1137Help
Entry
DICTH_1137        CDS       T00774                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
dth  Dictyoglomus thermophilum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:dth00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:dth00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1104933..1106408)
Genome map
AA seq 491 aa AA seqDB search
MKKLKEIVEYIKDHVIEVIGDVDLNITGIATDSRKVRKGNIFFALPGTKDDGKNYISDAI
SKGASAVFLEGEVNNIYGVPLVRVREILDVLSKVSSYFYDFPSKYLNIIGVTGTNGKTTT
TNLLYHYWKSKGIRSGLIGTIEYKIDDESYPSNFTTPQPQDLQEILRKMVDREVKFLAME
ISSHALALKRVDGISLKGAVFTNLTQDHLDFHKTMEEYFQAKLKIFNYLEDGGFAVINRD
NEWTGRISLPNRRVFWVSLKNGDLYLKKHENTNNGMLLEIGTPLGDLIIDTKLKGKFNIY
NILFAVGVLIGLGEPLEDISKFLSTFKGVKGRLELIREGQNFDVIVDYAHTPDGLFNVLQ
TVKEFTKGRVIVVFGCGGDRDPTKRDKMGEISARLADIVIVTSDNPRTEDPLKIIRQIEE
GIRRVGRSDYFVIENREEAIKKAIEIAGEGDSVLIAGKGHEDYQIIGNTKIPFSDQEVAK
KYILERLKNES
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaactgaaagaaatagttgaatacataaaagaccatgttattgaagttattggt
gatgttgatttaaatattacgggtatagctacagattcaagaaaagttagaaagggcaat
atcttctttgctcttccagggacaaaagatgatggaaagaattatataagtgatgctatc
tcaaaaggagcaagtgcagtatttcttgagggagaagttaataatatttatggtgtacct
ttagtaagagtaagagaaatattggatgtgcttagtaaggtttcttcttatttttatgat
tttccctctaaatatctaaatatcattggagttacaggtactaacggaaaaactactact
acaaacctgttatatcattattggaaaagtaaaggtataaggtctggtttaattggtact
attgagtataaaatagatgatgagtcttatccttccaattttaccactcctcaacctcag
gaccttcaagaaattttaaggaagatggtagatagagaagttaagtttttagccatggag
atttcttctcatgcattggctttgaaaagagtcgatgggatatccttaaagggagcagtg
tttactaacttgactcaagatcatcttgattttcataagactatggaagaatattttcag
gcaaagttaaaaatttttaattacttggaggatggaggatttgcagtaataaatagagac
aatgaatggacaggaagaatttctcttccaaatagaagagttttctgggtatctcttaaa
aatggagatctatatttaaaaaagcatgaaaatactaataatggaatgcttcttgagata
ggtactcctttaggtgatctgataattgatacaaaattaaagggaaagttcaatatatat
aacattctttttgcagtaggcgtacttattggattaggagagcctttagaggatatttct
aaatttctttctacttttaaaggtgtaaagggaagacttgagcttataagagaaggacag
aattttgatgtgattgtagattatgctcatactcctgatgggctttttaacgttttacag
actgttaaagaatttacaaaaggtagagttatagtggtttttggttgtggaggagataga
gatcctacaaagagagacaaaatgggggagatatccgcaaggcttgcagatatagtcata
gttacttctgataatccaagaacggaggatcctttaaaaattataaggcagattgaagag
ggtataaggagagtaggaagatcggattactttgtgattgaaaatagagaagaagcaata
aagaaggctattgagatagctggagaaggagattcagtattaatagcgggtaagggacat
gaggattatcaaataattgggaacacaaagattccttttagtgatcaagaagtagccaag
aaatatattctagagaggttaaaaaatgagtcttaa

DBGET integrated database retrieval system