KEGG   Dictyoglomus thermophilum: DICTH_1253Help
Entry
DICTH_1253        CDS       T00774                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dth  Dictyoglomus thermophilum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DICTH_1253 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DICTH_1253 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DICTH_1253 (thrC)
Enzymes [BR:dth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DICTH_1253 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1201371..1202411
Genome map
AA seq 346 aa AA seqDB search
MSGVLIRYKELLPITENTPMITLHEGDTPLIYANNLSKKYGIDVWLKYEGMNPTGSFKDR
GMVVAIAKALEEKSEMVICASTGNTAASAAAYAALTNLKAFVVLPEKAIALGKLAQAIMY
GAKIISVKGNFDDALKLVREISQKFPITLVNSINPYRLEGQKTAAFEICDVLKRNPENLA
IPVGNAGNISAYWMGFKEYYKIGKIKELPKMLGFQAEGAAPLVKGHPIPNPQTIATAIKI
GNPASWDKAINAVRESSGLIDTVSDEEILEAQKELASKEGVFVEPASAASWAGVKKLLKE
NRFPGEEVVCVLTGHGLKDPDIAIKQAKIDISIEPKIEEFQKIIEK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcgtattaataagatataaagagcttcttcctataaccgaaaatacacctatg
ataaccctacacgaaggagatacaccattaatatacgctaacaatctatcaaagaaatat
ggaatagatgtatggcttaaatatgagggtatgaatcctacagggtcttttaaagacagg
ggtatggttgtagcaatcgctaaagccttagaagaaaaaagtgagatggtcatatgcgcc
tcgacaggaaatactgctgcctctgcagccgcttatgctgctcttacaaacctaaaagcc
tttgtagtactaccagaaaaagcaattgccttaggcaagcttgcccaggccataatgtac
ggagcaaagataatcagcgtcaaaggtaacttcgacgatgctcttaaattggtaagagag
atttctcaaaagtttcctattaccttggtaaactctataaatccctataggttggaaggg
caaaaaacagcagcttttgaaatctgcgatgttctaaaaagaaatcctgaaaacttagct
attcctgtaggaaatgctggaaacatttcagcttattggatggggtttaaggaatattat
aaaataggaaaaataaaggaattacctaaaatgcttggatttcaagcagaaggcgctgca
cctctagtgaaaggtcatcctatccccaatcctcaaactatagccactgcgataaaaata
ggaaatcctgcaagttgggacaaggctataaatgcagttagagaatcttcaggtttaatc
gatacagtttctgacgaagaaatattagaagcccaaaaagagttagcctcaaaagaaggc
gtatttgtagaaccagcctcggcagcctcatgggcaggagtaaagaaacttttaaaagaa
aatagatttccaggagaagaagtggtatgtgttctcacagggcacggtttaaaggatcca
gacatagctataaaacaagccaaaatcgatatctccattgaacctaaaatagaagaattt
caaaaaataatagaaaaatga

DBGET integrated database retrieval system