KEGG   Dictyoglomus thermophilum: DICTH_1280Help
Entry
DICTH_1280        CDS       T00774                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dth  Dictyoglomus thermophilum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DICTH_1280 (pfkA)
   01230 Biosynthesis of amino acids
    DICTH_1280 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DICTH_1280 (pfkA)
   00030 Pentose phosphate pathway
    DICTH_1280 (pfkA)
   00051 Fructose and mannose metabolism
    DICTH_1280 (pfkA)
   00052 Galactose metabolism
    DICTH_1280 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    DICTH_1280 (pfkA)
Enzymes [BR:dth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DICTH_1280 (pfkA)
Protein phosphatases and associated proteins [BR:dth01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     DICTH_1280 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1222096..1223055)
Genome map
AA seq 319 aa AA seqDB search
MIKRIGVLTSGGDAPGMNSAIRAIVRFGISKGIEVIGIERGYQGLIEEEFRVLHKDDVSE
IVQRGGTILRTARSEEFKEEEGQRRAIENLKKHGIDGLIVIGGEGSLKGAYDLFKKGVNV
VGIPGSIDNDIWGTDFSIGFDTACNNVIDAINKIRDTAAAHERTFVIEVMGRECGFIAFT
SGLVSGADIILIPEVPIDFPYITEKLKERQRKNKKHNIIVVAEGVGSAYFIGKQIEDRLG
ISTRIVVLGHIQRGGSPSVFDRSIATFMGVDAVKRLLAGESGVMIGWQNNSPVSVPLEEV
VKNKKRVSPELYWEVESLW
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgattaagagaataggtgttcttacaagcgggggagatgctcctggaatgaattctgct
ataagggctattgtaaggttcggaatatctaagggaatagaagttataggaattgaacga
ggatatcagggattaattgaagaagagtttagagtacttcataaggatgatgtgagtgag
atagttcaaagaggtggtactattctgcgtactgcaagatctgaggaatttaaagaagag
gaaggacaaagaagggctattgaaaatctaaaaaaacatggaatagatggtttaattgtt
attggtggtgaaggttctcttaaaggcgcttatgatctatttaagaaaggtgtcaatgta
gtagggattcctgggagtattgacaatgatatatggggtacagatttttctataggtttt
gatactgcatgcaataatgttatagatgcaataaacaagatcagagatacagctgctgct
catgagaggacttttgttattgaggttatgggaagggaatgtggttttatagcctttact
tcaggacttgttagtggtgcagatataattctcatacctgaggttcctatagattttcct
tatattactgagaaattgaaagaaagacagagaaaaaataaaaaacacaatattattgta
gttgcagaaggagtaggaagtgcttattttattggtaagcagattgaggatagacttgga
atatccacaagaattgtagttcttggacatatccaaagaggaggttctccctcggtcttt
gataggagtatagctacctttatgggggttgatgcagtgaaaagacttcttgctggagaa
agtggagtgatgatagggtggcaaaataattctcctgtttctgttcctcttgaggaagtt
gtaaaaaataaaaagcgagtttcaccagaactttactgggaagtggaatctttatggtaa

DBGET integrated database retrieval system