KEGG   Dictyoglomus thermophilum: DICTH_1383Help
Entry
DICTH_1383        CDS       T00774                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dth  Dictyoglomus thermophilum
Pathway
dth00900  Terpenoid backbone biosynthesis
dth01100  Metabolic pathways
dth01110  Biosynthesis of secondary metabolites
dth01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DICTH_1383 (ispE)
Enzymes [BR:dth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     DICTH_1383 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACI19699
UniProt: B5YF94
Position
1319261..1320124
Genome map
AA seq 287 aa AA seqDB search
MERLNIYTFGKITLFLDVINKREDGYHNIKILLHNINLWDFMQISPLPYPKFIINSNLNI
PLEENLVYKAYKKFIETTGRKIGVRIFLYKKIPIQAGLGGGSSNAAGIIWGLNILTKSNL
SLKEMANIGETLGSDVPFFFYGGSCVAEGKGELITKISHQNFKFLLILPPYGISTRDIYS
KIKKEDLGTHINFEEIISNFEKGFLSKPYNFFEKIVFEEYQELREIKELISEITPYVALT
GTGSTMFVLIRDDSEIKKIIKKIEEYLAKGYKIRSVKSSPLGIKILR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggaaagattaaacatatatacttttggtaaaataactctttttcttgacgtaataaat
aaaagagaagatggataccataatataaaaatacttctccataacataaatttatgggac
ttcatgcaaatctcaccactaccctatcctaaattcattataaattctaatctcaatatc
ccattagaggaaaatcttgtatacaaggcctataaaaaatttattgaaaccacgggaaga
aagataggagtaagaatatttttatacaaaaaaataccaatacaagcaggccttggcggt
ggtagctctaatgcagcaggaataatttggggcttaaatattctcaccaaatcaaatctt
tctttaaaagaaatggcaaatataggagaaactttaggctctgacgttcctttcttcttt
tatggaggatcatgtgtagcagaaggaaagggggaactaatcacaaagatatcacaccaa
aactttaaatttcttctaatacttcctccctatggcataagcacaagggacatttactca
aaaataaaaaaagaagatttaggaactcatataaattttgaagaaattatatcaaacttt
gaaaaaggcttcctttcaaaaccttataacttctttgaaaaaatagtctttgaggaatat
caggaattaagagagataaaagaattaatatcagaaataaccccctatgtggctctgaca
ggcacaggctctaccatgtttgtgttaattagagatgactctgagattaaaaaaatcatt
aaaaaaatcgaggaatacttagccaaaggttataaaataaggtctgtaaagtcaagtcct
ttaggaataaaaattttaagataa

DBGET integrated database retrieval system