KEGG   Dictyoglomus thermophilum: DICTH_1516Help
Entry
DICTH_1516        CDS       T00774                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dth  Dictyoglomus thermophilum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DICTH_1516 (galU)
   00052 Galactose metabolism
    DICTH_1516 (galU)
   00500 Starch and sucrose metabolism
    DICTH_1516 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    DICTH_1516 (galU)
Enzymes [BR:dth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     DICTH_1516 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1459486..1460352)
Genome map
AA seq 288 aa AA seqDB search
MSINKAVFPAAGLGTRFLPATKAQPKEMLPVVDKPIIQYAVEEAVNSGIDEIIIVTGRNK
RAIEDHFDISFELEYFLQKKGELDLLRQVREISELATVYYIRQKEPLGLGHAVLVTKELV
KNEPFAVILSDDLIVSDVPCMKQMIEIYERYKCSVIAVERVPKDEVKNYGVIAGKKIDEG
IYQVTDLVEKPSVDEAPSDLAIVGRYILTPEIFPMLEKVKPGRGGEIQLTDGLKMLLEKE
AIYAYEFKGKRYDTGSKLGFLIASVELALKREGLGEQFKEYLKTLNLD
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgtctataaataaggctgtctttcctgctgcaggtcttggtactagatttcttccagct
acaaaggcgcaacctaaggagatgcttcctgtagtggataagcctataattcaatatgca
gtagaggaggctgtaaattctggaattgacgagataattattgtcacaggcaggaataag
agggcgatcgaagatcattttgatatatcttttgaactggaatatttcttacagaaaaaa
ggagaattggacttactgagacaggtaagggagatctcagagcttgctactgtctattat
attaggcagaaagaacctcttgggcttggtcatgctgttttggttaccaaagaacttgtt
aagaatgaaccttttgctgtaattttgagcgatgatcttattgtaagtgatgtgccttgt
atgaaacagatgatagagatatatgaaagatacaaatgctcagtcatagctgtagagaga
gttccaaaagacgaggttaaaaattatggggttatagcaggtaagaagattgatgagggt
atatatcaagtaactgatcttgtagagaaaccgtcggtagatgaggcaccttctgatctt
gctattgtaggaaggtatatattaactcctgagatatttcctatgcttgagaaagttaag
cctggaagagggggagaaatacagcttacggatgggttgaaaatgcttttggagaaagaa
gccatatatgcttatgaatttaaaggtaagaggtatgatacaggtagtaaacttggattt
ttaatagcctcagtagagcttgctcttaaaagagaaggacttggagaacaatttaaagaa
tatcttaaaactctaaatttagattag

DBGET integrated database retrieval system