KEGG   Dictyoglomus thermophilum: DICTH_1572Help
Entry
DICTH_1572        CDS       T00774                                 

Definition
xylose repressor
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
dth  Dictyoglomus thermophilum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DICTH_1572
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DICTH_1572
   00052 Galactose metabolism
    DICTH_1572
   00500 Starch and sucrose metabolism
    DICTH_1572
   00520 Amino sugar and nucleotide sugar metabolism
    DICTH_1572
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DICTH_1572
   00524 Butirosin and neomycin biosynthesis
    DICTH_1572
Enzymes [BR:dth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     DICTH_1572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1512811..1513938)
Genome map
AA seq 375 aa AA seqDB search
MREGRKPEYIGLYNKNLVLEILIKTGPKSRAELARISKLTKTAISEIVDELIEKNILVEI
GKVETSRGRRPTKLTINPDLKILAIDLSGLEGRSGIVDASGKVEEDFYYPIKRKEDLFEL
IDPLLKKYKNIIAISISVPGIINKYNGEVILSVGLNWRNFLLKEFLKERYPNLPIYIEKD
TNSGLLSELWFGEGKKFNILFYLLFEKGIGLGIYYNGNIIEGFNNIEGEIGHTIVNGDIA
EICWCGNKGCLETIASFPKIQEKFSDFKLLEESLKSYNQGDKDPFLEEIFRYLGISLANA
VHIIAPEAICVAGNRGMTRNILNLFTEILKKEVDKYIFEYLKDKIYFYASPLGNDGLLIG
AGILGFTNYFRELVK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagagagggaagaaaaccagaatatataggcttgtataataaaaatcttgttcttgag
attcttataaaaactggtcctaagtcgagggcagaacttgcaagaatttctaaactaaca
aagacagccatatctgagatagtagatgaactcattgagaaaaatattcttgtggagatt
ggaaaagttgagacttcaagggggagaagacccacaaaactaactattaatcctgattta
aagattttagcaattgatttaagcggtttagaaggaagatcaggaattgttgatgcctca
ggaaaggttgaagaagatttttattatcctataaagaggaaggaagacctttttgagctt
atagatcctcttctcaagaagtataaaaatataatagccatatctatttcagttcctggt
attataaataagtataatggagaggtaatactttcggtgggactcaattggagaaatttt
cttttaaaggaatttttgaaagagaggtatcctaatcttcctatttacattgagaaggat
actaattcgggacttttatcggaactctggtttggcgaaggtaagaaatttaatattctt
ttctacttattgtttgagaaaggaataggacttggaatttattataatggtaatatcata
gaaggctttaataatattgagggagagataggtcataccatagtaaatggagatatagca
gagatatgttggtgtggaaataaaggctgtctggaaactattgcgtctttcccaaagatt
caagaaaaattttcagattttaaacttttagaagaaagccttaaaagctataatcaaggg
gataaagatcctttcttagaagaaatcttcagatatctcggtatatccttggcaaatgct
gtgcacattattgctcctgaagcaatatgcgttgctggaaataggggaatgacaaggaat
attttgaacctgtttaccgagattcttaaaaaagaagttgataagtatatttttgaatat
ctaaaggataaaatatacttttatgcatcacctcttggaaatgatggcctgcttattggg
gcaggcatcttaggctttacaaattattttagagaattggtaaaataa

DBGET integrated database retrieval system