KEGG   Dictyoglomus thermophilum: DICTH_1588Help
Entry
DICTH_1588        CDS       T00774                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
dth  Dictyoglomus thermophilum
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:dth00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dth00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1528838..1529944
Genome map
AA seq 368 aa AA seqDB search
MPFVDHRAQKIRRSKEELLKHMQTFKLDLKFSVGIWYFTPGGGRFHEPYVEQKSIPERIE
MAAEMAKFGVKGIEAHYPAEVNEENLHLYKQLEKEAGIRLVAVPLSLFYDKIFEFGSLSN
PYEKYRKVAYERLVNGLKLVKEANADICIIWPGIDGYTYSYGHLYYHMWDTFEELVAQAM
DEVPGVQVAIEPKPYEPAPNNIYRTTADGILAARDIEARLKNPENLKLLQEGHALVGLNP
EVGHVRMGFEDLPYAYARVAREGRLFHTHWNSQPLGNYDQDLNIGVVDWDSTEALLYTLK
MVGYQGYFGIDINPERMPVIKAIEINTKVLQIMNERIERLPHDRIIECYFDPENHRGELE
LILAENHK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgtagatcaccgcgcacaaaaaattagaagatccaaagaggaactcttaaaa
cacatgcaaacttttaaattagatcttaaattctcggtaggaatttggtactttactcct
ggtggtggaagattccatgagccttacgtagaacaaaagagtataccagaaagaatcgag
atggctgctgaaatggccaaatttggagtaaaaggaattgaggcccactatcctgcagag
gtaaacgaagaaaatctccatctatacaaacaactagaaaaagaagcaggaataagactc
gtcgctgtaccattaagcttattctacgataaaatttttgagtttggctctctctctaat
ccctacgaaaaatacagaaaagtagcctatgaaagattagtaaatggattaaaactagta
aaagaggctaacgctgatatttgcattatttggcctggaatcgatggatatacttactct
tatggacatctctactaccatatgtgggacacttttgaagaattagtagctcaggctatg
gatgaagtgcctggagtacaggtggcaatagagccaaaaccctacgaacctgctcctaat
aacatatacagaactactgctgatggaatccttgctgcaagagatattgaggccaggtta
aaaaatcctgaaaacttgaagttattacaggaaggacatgccctcgtaggacttaatcca
gaagtaggccatgtaagaatgggatttgaagacctaccatatgcctatgccagagtagca
agagaaggaagactattccatactcattggaatagccaacccttaggaaactatgaccag
gatttgaacataggagtggttgattgggattccaccgaagctctcctatatactctaaag
atggtaggatatcaaggatactttggaatagacataaacccagaaagaatgcctgtaatc
aaagccattgaaatcaatactaaagtccttcaaatcatgaatgaaagaattgaaagatta
cctcatgatagaatcattgagtgctactttgatccagaaaatcatagaggtgagcttgaa
ttaattcttgccgaaaatcataaatag

DBGET integrated database retrieval system